-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Dopamine beta Hydroxylase was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-250 of human Dopamine beta Hydroxylase (NP_000778.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Dopamine beta Hydroxylase was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 100-250 of human Dopamine beta Hydroxylase (NP_000778.3) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15364A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Dopamine beta Hydroxylase |
| Target Synonyms | DBM; ORTHYP1; Dopamine beta Hydroxylase | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 100-250 of human Dopamine beta Hydroxylase (NP_000778.3). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LVVLWTDGDTAYFADAWSDQKGQIHLDPQQDYQLLQVQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHLVYGILEEPFRSLEAINGSGLQMGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKGFSRHHIIKYE | Uniprot ID | P09172 |
Uniprot Id
P09172
Target Species
Human
Target Name
DBH
Target Full Name
Dopamine beta-hydroxylase
Target Function
Conversion of dopamine to noradrenaline.
Target Involvement
Dopamine beta-hydroxylase deficiency (DBH deficiency)
Target Subcellular Location
[Soluble dopamine beta-hydroxylase]: Cytoplasmic vesicle, secretory vesicle lumen. Cytoplasmic vesicle, secretory vesicle, chromaffin granule lumen. Secreted.; Cytoplasmic vesicle, secretory vesicle membrane; Single-pass type II membrane protein. Cytoplasmic vesicle, secretory vesicle, chromaffin granule membrane; Single-pass type II membrane protein.
Target Protein Families
Copper type II ascorbate-dependent monooxygenase family
Target Research Area
Neuroscience
Target Synonyms
dbh; DBM; Dopamine beta hydroxylase; Dopamine beta monooxygenase; Dopamine beta-hydroxylase (dopamine beta-monooxygenase); Dopamine beta-monooxygenase; DOPO_HUMAN; OTTHUMP00000022501; Soluble dopamine beta-hydroxylase
Target Background
The protein encoded by this gene is an oxidoreductase belonging to the copper type II, ascorbate-dependent monooxygenase family. The encoded protein, expressed in neuroscretory vesicles and chromaffin granules of the adrenal medulla, catalyzes the conversion of dopamine to norepinephrine, which functions as both a hormone and as the main neurotransmitter of the sympathetic nervous system. The enzyme encoded by this gene exists exists in both soluble and membrane-bound forms, depending on the absence or presence, respectively, of a signal peptide. Mutations in this gene cause dopamine beta-hydroxylate deficiency in human patients, characterized by deficits in autonomic and cardiovascular function, including hypotension and ptosis. Polymorphisms in this gene may play a role in a variety of psychiatric disorders.
Notification