-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EBP1/PA2G4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-394 of human EBP1/PA2G4 (NP_006182.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against EBP1/PA2G4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 300-394 of human EBP1/PA2G4 (NP_006182.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-13943A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EBP1/PA2G4 |
| Target Synonyms | EBP1; HG4-1; ITAF45; p38-2G4; EBP1/PA2G4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, 293T, Jurkat, Mouse brain, Mouse lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 300-394 of human EBP1/PA2G4 (NP_006182.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALLQSSASRKTQKKKKKKASKTAENATSGETLEENEAGD | Uniprot ID | Q9UQ80 |
Uniprot Id
Q9UQ80
Target Species
Human
Target Name
PA2G4
Target Full Name
Proliferation-associated protein 2G4
Target Function
May play a role in a ERBB3-regulated signal transduction pathway. Seems be involved in growth regulation. Acts a corepressor of the androgen receptor (AR) and is regulated by the ERBB3 ligand neuregulin-1/heregulin (HRG). Inhibits transcription of some E2F1-regulated promoters, probably by recruiting histone acetylase (HAT) activity. Binds RNA. Associates with 28S, 18S and 5.8S mature rRNAs, several rRNA precursors and probably U3 small nucleolar RNA. May be involved in regulation of intermediate and late steps of rRNA processing. May be involved in ribosome assembly. Mediates cap-independent translation of specific viral IRESs (internal ribosomal entry site). Regulates cell proliferation, differentiation, and survival. Isoform 1 suppresses apoptosis whereas isoform 2 promotes cell differentiation.
Target Subcellular Location
[Isoform 1]: Cytoplasm. Nucleus, nucleolus.; [Isoform 2]: Cytoplasm.
Target Protein Families
Peptidase M24 family
Target Tissue Specificity
Isoform 2 is undetectable whereas isoform 1 is strongly expressed in cancer cells (at protein level). Isoform 1 and isoform 2 are widely expressed, including heart, brain, lung, pancreas, skeletal muscle, kidney, placenta and liver.
Target Synonyms
38kDa; AA672939; Cell cycle protein p38 2G4 homolog; Cell cycle protein p38-2G4 homolog; ErbB-3 binding protein 1 ; ErbB3 binding protein 1 ; ErbB3-binding protein 1; ErbB3-binding protein Ebp1 ; hG4 1; hG4-1; IRES-specific cellular trans-acting factor 45 kDa; MGC81621; MGC94070; Mpp1; p38 2G4 ; Pa2g4; PA2G4_HUMAN; Plfap; Proliferation associated 2G4; Proliferation associated 2G4; 38-KD; Proliferation-associated 2G4; 38kDa ; Proliferation-associated 2G4; a; Proliferation-associated protein 1; Proliferation-associated protein 2G4; Protein p38-2G4; si:dz150i12.2; wu:fb19b11; wu:ft56d05; zgc:86732
Target Background
This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells. Six pseudogenes, located on chromosomes 3, 6, 9, 18, 20 and X, have been identified.
Notification