Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against eIF2B epsilon (EIF2B5) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF2B epsilon (EIF2B5) (EIF2B5) (Q13144) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against eIF2B epsilon (EIF2B5) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF2B epsilon (EIF2B5) (EIF2B5) (Q13144) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14200A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | eIF2B epsilon (EIF2B5) |
| Target Synonyms | CLE; CACH; LVWM; EIF-2B; EIF2Bepsilon; eIF2B epsilon (EIF2B5) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, HT-29, U-87MG | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human eIF2B epsilon (EIF2B5) (EIF2B5) (Q13144). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAAPVVAPPGVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPISKDQPRVLLPLANVALIDYTLEFLTATGVQETFVFCCWKAA | Uniprot ID | Q13144 |
Uniprot Id
Q13144
Target Species
Human
Target Name
EIF2B5
Target Full Name
Translation initiation factor eIF2B subunit epsilon
Target Function
Catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP.
Target Involvement
Leukodystrophy with vanishing white matter (VWM)
Target Protein Families
EIF-2B gamma/epsilon subunits family
Target Synonyms
CACH; CLE; EI2BE_HUMAN; EIF 2B; eIF 2B GDP GTP exchange factor; eIF 2B GDP GTP exchange factor subunit epsilon; eIF-2B GDP-GTP exchange factor subunit epsilon; EIF2B; EIF2B5; EIF2BE; EIF2Bepsilon; Eukaryotic Translation Initiation Factor 2 Beta Epsilon; Eukaryotic translation initiation factor 2B subunit 5 epsilon 82kDa; Eukaryotic translation initiation factor 2B subunit 5 epsilon; LVWM; Translation initiation factor eIF 2B subunit epsilon; Translation initiation factor eIF-2B subunit epsilon
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
