Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EIF4A1/EIF4A2/EIF4A3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human EIF4A1/EIF4A2/EIF4A3 (NP_001407.1?/NP_001958.2?/NP_055555.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
The antibody against EIF4A1/EIF4A2/EIF4A3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human EIF4A1/EIF4A2/EIF4A3 (NP_001407.1?/NP_001958.2?/NP_055555.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ELISA.
Western blot analysis of various lysates, using EIF4A1/EIF4A2/EIF4A3 Rabbit mAb at 1:20000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 30s.
| Cat.No | ADA-15477A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EIF4A1/EIF4A2/EIF4A3 |
| Target Synonyms | DDX2A; EIF4A; EIF-4A; eIF4A-I; eIF-4A-I; DDX2B; EIF4F; BM-010; eIF4A-II; eIF-4A-II; Fal1; RCPS; DDX48; MUK34; NUK34; NMP265; eIF4AIII; eIF4A-III; eIF-4A-III; EIF4A1/EIF4A2/EIF4A3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, C2C12, MCF7, PC-12 | Application | ELISA, WB, IF/ICC, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human EIF4A1/EIF4A2/EIF4A3 (NP_001407.1?/NP_001958.2?/NP_055555.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSASQDSRSRDNGPDGMEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKA | Uniprot ID | P60842, Q14240, P38919 |
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
