-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EMC4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human EMC4 (NP_057538.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against EMC4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human EMC4 (NP_057538.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14581A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EMC4 |
| Target Synonyms | PIG17; TMEM85; EMC4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat brain, Rat heart, 293T, Hep G2, Mouse brain, SH-SY5Y, U-87 MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human EMC4 (NP_057538.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MTAQGGLVANRGRRFKWAIELSGPGGGSRGRSDRGSGQGDSLYPVGYLDKQVPDTSVQETDRILVEKRCWDIALGPLKQIPMNLFIMYMAGNTISIFPTM | Uniprot ID | Q5J8M3 |
Uniprot Id
Q5J8M3
Target Species
Human
Target Name
EMC4
Target Full Name
ER membrane protein complex subunit 4
Target Function
Part of the endoplasmic reticulum membrane protein complex (EMC) that enables the energy-independent insertion into endoplasmic reticulum membranes of newly synthesized membrane proteins. Preferentially accommodates proteins with transmembrane domains that are weakly hydrophobic or contain destabilizing features such as charged and aromatic residues. Involved in the cotranslational insertion of multi-pass membrane proteins in which stop-transfer membrane-anchor sequences become ER membrane spanning helices. It is also required for the post-translational insertion of tail-anchored/TA proteins in endoplasmic reticulum membranes. By mediating the proper cotranslational insertion of N-terminal transmembrane domains in an N-exo topology, with translocated N-terminus in the lumen of the ER, controls the topology of multi-pass membrane proteins like the G protein-coupled receptors. By regulating the insertion of various proteins in membranes, it is indirectly involved in many cellular processes (Probable).
Target Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
EMC4 family
Target Tissue Specificity
Isoform 1 is expressed in brain and heart. Isoform 2 is expressed in heart.
Target Synonyms
EMC4; TMEM85; HSPC184; PIG17; ER membrane protein complex subunit 4; Cell proliferation-inducing gene 17 protein; Transmembrane protein 85
Target Background
Contributes to membrane insertase activity. Involved in protein insertion into ER membrane by stop-transfer membrane-anchor sequence and tail-anchored membrane protein insertion into ER membrane. Is integral component of endoplasmic reticulum membrane. Part of EMC complex.
Notification