-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against EXOSC7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 192-291 of human EXOSC7 (Q15024) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against EXOSC7 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 192-291 of human EXOSC7 (Q15024) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14454A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | EXOSC7 |
| Target Synonyms | p8; EAP1; RRP42; Rrp42p; hRrp42p; EXOSC7 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-431, HepG2, K-562, U-251MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 192-291 of human EXOSC7 (Q15024). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LSVENVPCIVTLCKIGYRHVVDATLQEEACSLASLLVSVTSKGVVTCMRKVGKGSLDPESIFEMMETGKRVGKVLHASLQSVVHKEESLGPKRQKVGFLG | Uniprot ID | Q15024 |
Uniprot Id
Q15024
Target Species
Human
Target Name
EXOSC7
Target Full Name
Exosome complex component RRP42
Target Function
Non-catalytic component of the RNA exosome complex which has 3'->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snRNA and snoRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. The RNA exosome may be involved in Ig class switch recombination (CSR) and/or Ig variable region somatic hypermutation (SHM) by targeting AICDA deamination activity to transcribed dsDNA substrates. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs. It seems to be involved in degradation of histone mRNA. The catalytic inactive RNA exosome core complex of 9 subunits (Exo-9) is proposed to play a pivotal role in the binding and presentation of RNA for ribonucleolysis, and to serve as a scaffold for the association with catalytic subunits and accessory proteins or complexes
Target Subcellular Location
Nucleus, nucleolus. Cytoplasm. Nucleus.
Target Protein Families
RNase PH family
Target Synonyms
EAP1; EXOS7_HUMAN; Exosc7; Exosome complex component RRP42; Exosome complex exonuclease RRP42 ; Exosome component 7; FLJ26543; hRrp42p; KIAA0116; p8; Ribosomal RNA processing protein 42 ; Ribosomal RNA-processing protein 42; RRP42; Rrp42p
Notification