-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FSP1/S100A4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2-101 of human S100A4 (P26447) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against FSP1/S100A4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 2-101 of human S100A4 (P26447) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16872A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FSP1/S100A4 |
| Target Synonyms | 42A; 18A2; CAPL; FSP1; MTS1; P9KA; PEL98; FSP1/S100A4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, Rat heart, A-549, A375 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 2-101 of human S100A4 (P26447). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ACPLEKALDVMVSTFHKYSGKEGDKFKLNKSELKELLTRELPSFLGKRTDEAAFQKLMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGFPDKQPRKK | Uniprot ID | P26447 |
Uniprot Id
P26447
Target Species
Human
Target Name
S100A4
Target Full Name
Protein S100-A4
Target Function
Calcium-binding protein that plays a role in various cellular processes including motility, angiogenesis, cell differentiation, apoptosis, and autophagy. Increases cell motility and invasiveness by interacting with non-muscle myosin heavy chain (NMMHC) IIA/MYH9. Mechanistically, promotes filament depolymerization and increases the amount of soluble myosin-IIA, resulting in the formation of stable protrusions facilitating chemotaxis. Modulates also the pro-apoptotic function of TP53 by binding to its C-terminal transactivation domain within the nucleus and reducing its protein levels. Within the extracellular space, stimulates cytokine production including granulocyte colony-stimulating factor and CCL24 from T-lymphocytes. In addition, stimulates T-lymphocyte chemotaxis by acting as a chemoattractant complex with PGLYRP1 that promotes lymphocyte migration via CCR5 and CXCR3 receptors.
Target Subcellular Location
Secreted. Nucleus. Cytoplasm.
Target Protein Families
S-100 family
Target Tissue Specificity
Ubiquitously expressed.
Target Synonyms
18A2; 42A; calcium Placental protein; Calvasculin; CAPL; Fibroblast specific protein 1 (FSP1); Fibroblast specific protein 1; Fibroblast specific protein; FSP1; Leukemia multidrug resistance associated protein; Malignant transformation suppression 1 (MTS1); Malignant transformation suppression 1; Metastasin; MTS1; OTTHUMP00000015467; OTTHUMP00000015468; P9KA; PEL98; Placental calcium-binding protein; Protein Mts1; Protein S100 A4; Protein S100-A4; S100 calcium binding protein A4 (calcium protein, calvasculin, metastasin, murine placental homolog); S100 calcium binding protein A4; S100 calcium-binding protein A4; S100a4; S10A4_HUMAN
Target Background
The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in motility, invasion, and tubulin polymerization. Chromosomal rearrangements and altered expression of this gene have been implicated in tumor metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Notification