Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against GLYAT/GAT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human GLYAT/GAT (NP_964011.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against GLYAT/GAT was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human GLYAT/GAT (NP_964011.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
Western blot analysis of lysates from Mouse kidney, using GLYAT/GAT Rabbit mAb at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Exposure time: 45s.
| Cat.No | ADA-15581A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | GLYAT/GAT |
| Target Synonyms | CAT; GAT; ACGNAT; GLYAT/GAT | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse kidney | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human GLYAT/GAT (NP_964011.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MMLPLQGAQMLQMLEKSLRKSLPASLKVYGTVFHINHGNPFNLKAVVDKWPDFNTVVVCPQEQDMTDDLDHYTNTYQIYSKDPQNCQEFLGSPELINWKQ | Uniprot ID | Q6IB77 |
Uniprot Id
Q6IB77
Target Species
Human
Target Name
GLYAT
Target Full Name
Glycine N-acyltransferase
Target Function
Mitochondrial acyltransferase which transfers an acyl group to the N-terminus of glycine and glutamine, although much less efficiently. Can conjugate numerous substrates to form a variety of N-acylglycines, with a preference for benzoyl-CoA over phenylacetyl-CoA as acyl donors. Thereby detoxify xenobiotics, such as benzoic acid or salicylic acid, and endogenous organic acids, such as isovaleric acid.
Target Subcellular Location
Mitochondrion.
Target Protein Families
Glycine N-acyltransferase family
Target Tissue Specificity
Predominantly expressed in liver (at protein level) and kidney. Down-regulated in hepatocellular carcinoma and other liver cancers.
Target Synonyms
GLYAT; ACGNAT; CAT; GATGlycine N-acyltransferase; EC 2.3.1.13; Acyl-CoA:glycine N-acyltransferase; AAc; Aralkyl acyl-CoA N-acyltransferase; Aralkyl acyl-CoA:amino acid N-acyltransferase; Benzoyl-coenzyme A:glycine N-acyltransferase; Glycine N-benzoyltransferase; EC 2.3.1.71; HRP-1(CLP)
Target Background
The glycine-N-acyltransferase protein conjugates glycine with acyl-CoA substrates in the mitochondria. The protein is thought to be important in the detoxification of endogenous and xenobiotic acyl-CoA's. Two transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
