-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HEC1/NDC80 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 543-642 of human HEC1/NDC80 (O14777) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HEC1/NDC80 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 543-642 of human HEC1/NDC80 (O14777) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13788A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HEC1/NDC80 |
| Target Synonyms | HEC; HEC1; TID3; KNTC2; HsHec1; hsNDC80; HEC1/NDC80 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Jurkat | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 543-642 of human HEC1/NDC80 (O14777). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ESTVNQGLSEAMNELDAVQREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHLEEQIAKVDREYEECMSEDLSENIKEIRDKYEKKATLIKSSEE | Uniprot ID | O14777 |
Uniprot Id
O14777
Target Species
Human
Target Name
NDC80
Target Full Name
Kinetochore protein NDC80 homolog
Target Function
Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity. Required for kinetochore integrity and the organization of stable microtubule binding sites in the outer plate of the kinetochore. The NDC80 complex synergistically enhances the affinity of the SKA1 complex for microtubules and may allow the NDC80 complex to track depolymerizing microtubules. Plays a role in chromosome congression and is essential for the end-on attachment of the kinetochores to spindle microtubules.
Target Subcellular Location
Nucleus. Chromosome, centromere, kinetochore. Note=Localizes to kinetochores from late prophase to anaphase. Localizes specifically to the outer plate of the kinetochore.
Target Protein Families
NDC80/HEC1 family
Target Synonyms
from Entrez Gene ,; HEC; Highly expressed in cancer; Highly expressed in cancer protein; Highly expressed in cancer rich in leucine heptad repeats; HsHec1; hsNDC80; Kinetochore associated 2; Kinetochore associated protein 2; Kinetochore protein Hec1; Kinetochore protein NDC80 homolog; Kinetochore-associated protein 2; KNTC2; ndc80; NDC80 homolog kinetochore complex component; NDC80 kinetochore complex component homolog; NDC80, S. cerevisiae, homolog of; NDC80_HUMAN; Retinoblastoma associated protein HEC; Retinoblastoma-associated protein HEC; TID3
Target Background
This gene encodes a component of the NDC80 kinetochore complex. The encoded protein consists of an N-terminal microtubule binding domain and a C-terminal coiled-coiled domain that interacts with other components of the complex. This protein functions to organize and stabilize microtubule-kinetochore interactions and is required for proper chromosome segregation.
Notification