Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HGD was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 346-445 of human HGD (Q93099) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HGD was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 346-445 of human HGD (Q93099) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13225A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HGD |
| Target Synonyms | AKU; HGO; HGD | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HepG2, HT-29 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 346-445 of human HGD (Q93099). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IRGHYEAKQGGFLPGGGSLHSTMTPHGPDADCFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHKCWEPLKSHFTPNSRNPAEPN | Uniprot ID | Q93099 |
Uniprot Id
Q93099
Target Species
Human
Target Name
HGD
Target Full Name
Homogentisate 1,2-dioxygenase
Target Involvement
Alkaptonuria (AKU)
Target Protein Families
Homogentisate dioxygenase family
Target Tissue Specificity
Highest expression in the prostate, small intestine, colon, kidney and liver.
Target Synonyms
2-dioxygenase; AKU; FLJ94126; hgd; HGD_HUMAN; HGO; Homogentisate 1 2 dioxygenase; Homogentisate 1; Homogentisate oxidase; Homogentisate oxygenase; Homogentisic acid oxidase; Homogentisicase
Target Background
This gene encodes the enzyme homogentisate 1, 2 dioxygenase. This enzyme is involved in the catabolism of the amino acids tyrosine and phenylalanine. Mutations in this gene are the cause of the autosomal recessive metabolism disorder alkaptonuria.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
