-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against hnRNP Q/SYNCRIP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 524-623 of human hnRNP Q/SYNCRIP (O60506) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against hnRNP Q/SYNCRIP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 524-623 of human hnRNP Q/SYNCRIP (O60506) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16149A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | hnRNP Q/SYNCRIP |
| Target Synonyms | PP68; NSAP1; GRYRBP; HNRNPQ; HNRPQ1; GRY-RBP; hnRNP-Q; hnRNP Q/SYNCRIP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse heart, Mouse brain, Rat lung, Rat spleen, Rat thymus | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 524-623 of human hnRNP Q/SYNCRIP (O60506). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | SQRGGPGSARGVRGARGGAQQQRGRGVRGARGGRGGNVGGKRKADGYNQPDSKRRQTNNQNWGSQPIAQQPLQGGDHSGNYGYKSENQEFYQDTFGQQWK | Uniprot ID | O60506 |
Uniprot Id
O60506
Target Species
Human
Target Name
SYNCRIP
Target Full Name
Heterogeneous nuclear ribonucleoprotein Q
Target Function
Heterogenous nuclear ribonucleoprotein (hnRNP) implicated in mRNA processing mechanisms. Component of the CRD-mediated complex that promotes MYC mRNA stability. Isoform 1, isoform 2 and isoform 3 are associated in vitro with pre-mRNA, splicing intermediates and mature mRNA protein complexes. Isoform 1 binds to apoB mRNA AU-rich sequences. Isoform 1 is part of the APOB mRNA editosome complex and may modulate the postranscriptional C to U RNA-editing of the APOB mRNA through either by binding to A1CF (APOBEC1 complementation factor), to APOBEC1 or to RNA itself. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain. Interacts in vitro preferentially with poly(A) and poly(U) RNA sequences. Isoform 3 may be involved in cytoplasmic vesicle-based mRNA transport through interaction with synaptotagmins. Component of the GAIT (gamma interferon-activated inhibitor of translation) complex which mediates interferon-gamma-induced transcript-selective translation inhibition in inflammation processes. Upon interferon-gamma activation assembles into the GAIT complex which binds to stem loop-containing GAIT elements in the 3'-UTR of diverse inflammatory mRNAs (such as ceruplasmin) and suppresses their translation; seems not to be essential for GAIT complex function.
Target Subcellular Location
Cytoplasm. Microsome. Endoplasmic reticulum. Nucleus.; [Isoform 1]: Nucleus, nucleoplasm.; [Isoform 2]: Nucleus, nucleoplasm.; [Isoform 3]: Nucleus, nucleoplasm.
Target Tissue Specificity
Ubiquitously expressed. Detected in heart, brain, pancreas, placenta, spleen, lung, liver, skeletal muscle, kidney, thymus, prostate, uterus, small intestine, colon, peripheral blood and testis.
Target Research Area
Immunology
Target Synonyms
cytoplasmic RNA-interacting protein; dJ3J17.2; Glycine and tyrosine rich RNA binding protein; Glycine- and tyrosine-rich RNA-binding protein; GRY RBP; GRY-RBP; GRYRBP; Heterogeneous nuclear ribonucleoprotein Q; hnRNP Q; HNRPQ; HNRPQ_HUMAN; HNRPQ1; NS1 associated protein 1; NS1-associated protein 1; NSAP1; pp68; RP1 3J17.2; Synaptotagmin binding cytoplasmic RNA interacting protein; Synaptotagmin-binding; Syncrip
Target Background
This gene encodes a member of the cellular heterogeneous nuclear ribonucleoprotein (hnRNP) family. hnRNPs are RNA binding proteins that complex with heterogeneous nuclear RNA (hnRNA) and regulate alternative splicing, polyadenylation, and other aspects of mRNA metabolism and transport. The encoded protein plays a role in multiple aspects of mRNA maturation and is associated with several multiprotein complexes including the apoB RNA editing-complex and survival of motor neurons (SMN) complex. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 20.
Notification