Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ICAM3 / CD50 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human ICAM3 / CD50 (P32942) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against ICAM3 / CD50 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human ICAM3 / CD50 (P32942) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13379A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ICAM3 / CD50 |
| Target Synonyms | CD50; CDW50; ICAM-R; ICAM3 / CD50 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Jurkat, U-937 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ICAM3 / CD50 (P32942). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | CNGSQITGSSNITVYRLPERVELAPLPPWQPVGQNFTLRCQVEDGSPRTSLTVVLLRWEEELSRQPAVEEPAEVTATVLASRDDHGAPFSCRTELDMQPQG | Uniprot ID | P32942 |
Uniprot Id
P32942
Target Species
Human
Target Name
ICAM3
Target Full Name
Intercellular adhesion molecule 3
Target Function
ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). ICAM3 is also a ligand for integrin alpha-D/beta-2. In association with integrin alpha-L/beta-2, contributes to apoptotic neutrophil phagocytosis by macrophages.
Target Subcellular Location
Membrane; Single-pass type I membrane protein.
Target Protein Families
Immunoglobulin superfamily, ICAM family
Target Tissue Specificity
Leukocytes.
Target Synonyms
ICAM3; Intercellular adhesion molecule 3; ICAM-3; CDw50; ICAM-R; CD antigen CD50
Target Background
The protein encoded by this gene is a member of the intercellular adhesion molecule (ICAM) family. All ICAM proteins are type I transmembrane glycoproteins, contain 2-9 immunoglobulin-like C2-type domains, and bind to the leukocyte adhesion LFA-1 protein. This protein is constitutively and abundantly expressed by all leucocytes and may be the most important ligand for LFA-1 in the initiation of the immune response. It functions not only as an adhesion molecule, but also as a potent signalling molecule. Alternative splicing results in multiple transcript variants encoding different isoforms.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
