Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Involucrin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human Involucrin (P07476) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against Involucrin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 100-200 of human Involucrin (P07476) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-16667A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Involucrin |
| Form | Liquid | Species Reactivity | Human, Mouse, Rat |
| Isotype | IgG | Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. |
| Purification Method | Affinity purification | Positive Samples | Rat lung |
| Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human Involucrin (P07476). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KAENPEQQLKQEKTQRDQQLNKQLEEEKKLLDQQLDQELVKRDEQLGMKKEQLLELPEQQEGHLKHLEQQEGQLKHPEQQEGQLELPEQQEGQLELPEQQE | Uniprot ID | P07476 |
Uniprot Id
P07476
Target Species
Human
Target Name
IVL
Target Full Name
Involucrin
Target Function
Part of the insoluble cornified cell envelope (CE) of stratified squamous epithelia.
Target Subcellular Location
Cytoplasm. Note=Constituent of the scaffolding of the cornified envelope.
Target Protein Families
Involucrin family
Target Tissue Specificity
Keratinocytes of epidermis and other stratified squamous epithelia.
Target Synonyms
INVO_HUMAN; Involucrin; IVL
Target Background
Involucrin, a component of the keratinocyte crosslinked envelope, is found in the cytoplasm and crosslinked to membrane proteins by transglutaminase. This gene is mapped to 1q21, among calpactin I light chain, trichohyalin, profillaggrin, loricrin, and calcyclin.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
