-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LDHA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human LDHA (P00338) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against LDHA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 200-300 of human LDHA (P00338) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-17252A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LDHA |
| Target Synonyms | LDHM; GSD11; PIG19; HEL-S-133P; HA | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, MCF7 | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human LDHA (P00338). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGI | Uniprot ID | P00338 |
Uniprot Id
P00338
Target Species
Human
Target Name
LDHA
Target Full Name
L-lactate dehydrogenase A chain
Target Involvement
Glycogen storage disease 11 (GSD11)
Target Subcellular Location
Cytoplasm.
Target Protein Families
LDH/MDH superfamily, LDH family
Target Research Area
Cancer, Metabolism
Target Synonyms
Cell proliferation-inducing gene 19 protein; GSD11; L lactate dehydrogenase B chain; L-lactate dehydrogenase A chain; Lactate dehydrogenase A; Lactate dehydrogenase B; Lactate dehydrogenase c variant 1; Lactate dehydrogenase c variant 3; Lactate dehydrogenase c variant 4; Lactate dehydrogenase C4; Lactate dehydrogenase H chain; Lactate dehydrogenase M; LDH A; LDH B; LDH H; LDH heart subunit; LDH M; LDH muscle subunit; LDH-A; LDH-M; LDH1; ldha; LDHA_HUMAN; LDHBD; LDHM; MS1111; PIG19; Proliferation inducing gene 19; Proliferation-inducing gene 19; Renal carcinoma antigen NY REN 46; Renal carcinoma antigen NY-REN-59; TRG 5; TRG5
Target Background
The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene.
Notification