-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against LysRS/KARS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 500-597 of human LysRS/KARS (Q15046) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against LysRS/KARS was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 500-597 of human LysRS/KARS (Q15046) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-16213A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | LysRS/KARS |
| Target Synonyms | KRS; KARS; KARS2; LEPID; CMTRIB; DEAPLE; DFNB89; LysRS/KARS | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, HeLa, 293T, Mouse testis, Rat testis | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 500-597 of human LysRS/KARS (Q15046). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV | Uniprot ID | Q15046 |
Uniprot Id
Q15046
Target Species
Human
Target Name
KARS1
Target Full Name
Lysine--tRNA ligase
Target Function
Catalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA. When secreted, acts as a signaling molecule that induces immune response through the activation of monocyte/macrophages. Catalyzes the synthesis of the signaling molecule diadenosine tetraphosphate (Ap4A), and thereby mediates disruption of the complex between HINT1 and MITF and the concomitant activation of MITF transcriptional activity.; (Microbial infection) Interacts with HIV-1 virus GAG protein, facilitating the selective packaging of tRNA(3)(Lys), the primer for reverse transcription initiation.
Target Involvement
Charcot-Marie-Tooth disease, recessive, intermediate type, B (CMTRIB); Deafness, autosomal recessive, 89 (DFNB89)
Target Subcellular Location
[Isoform Cytoplasmic]: Cytoplasm, cytosol. Cytoplasm. Nucleus. Cell membrane; Peripheral membrane protein. Secreted.; [Isoform Mitochondrial]: Mitochondrion.
Target Protein Families
Class-II aminoacyl-tRNA synthetase family
Target Synonyms
CMTRIB; DFNB89; EC 6.1.1.6; KARS 1; KARS 2; KARS; KARS1; KARS2; KIAA0070; KRS; Lysine tRNA ligase; Lysine--tRNA ligase; LysRS; Lysyl tRNA synthetase; Lysyl-tRNA synthetase; SYK_HUMAN
Target Background
Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Lysyl-tRNA synthetase is a homodimer localized to the cytoplasm which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Notification