Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MC5 Receptor was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MC5 Receptor (P33032) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MC5 Receptor was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MC5 Receptor (P33032) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13198A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MC5 Receptor |
| Target Synonyms | MC2; MC5 Receptor | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | DU145, Mouse brain, Mouse skeletal muscle, Mouse spleen, PC-12, Rat lung, Rat spleen | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MC5 Receptor (P33032). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGAIVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLN | Uniprot ID | P33032 |
Uniprot Id
P33032
Target Species
Human
Target Name
MC5R
Target Full Name
Melanocortin receptor 5
Target Function
Receptor for MSH (alpha, beta and gamma) and ACTH. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. This receptor is a possible mediator of the immunomodulation properties of melanocortins.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Expressed in the brain but not in the melanoma cells.
Target Research Area
Neuroscience
Target Synonyms
MC5R; Melanocortin receptor 5; MC5-R; MC-2
Target Background
This gene encodes a member of the seven-pass transmembrane G protein-coupled melanocortin receptor protein family that stimulate cAMP signal transduction. The encoded protein is a receptor for melanocyte-stimulating hormone and adrenocorticotropic hormone and is suggested to play a role in sebum generation.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
