-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MMP2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human MMP2 (P08253) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against MMP2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human MMP2 (P08253) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-17114A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Mmp2 |
| Target Synonyms | CLG4; MONA; CLG4A; MMP-2; TBE-1; MMP-II; MMP2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HCT116, Mouse lung, Rat lung, U-87MG | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 500-600 of human MMP2 (P08253). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RDKPMGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKMDP | Uniprot ID | P08253 |
Uniprot Id
P08253
Target Species
Human
Target Name
MMP2
Target Full Name
72 kDa type IV collagenase
Target Function
Ubiquitinous metalloproteinase that is involved in diverse functions such as remodeling of the vasculature, angiogenesis, tissue repair, tumor invasion, inflammation, and atherosclerotic plaque rupture. As well as degrading extracellular matrix proteins, can also act on several nonmatrix proteins such as big endothelial 1 and beta-type CGRP promoting vasoconstriction. Also cleaves KISS at a Gly-|-Leu bond. Appears to have a role in myocardial cell death pathways. Contributes to myocardial oxidative stress by regulating the activity of GSK3beta. Cleaves GSK3beta in vitro. Involved in the formation of the fibrovascular tissues in association with MMP14.; PEX, the C-terminal non-catalytic fragment of MMP2, posseses anti-angiogenic and anti-tumor properties and inhibits cell migration and cell adhesion to FGF2 and vitronectin. Ligand for integrinv/beta3 on the surface of blood vessels.; Mediates the proteolysis of CHUK/IKKA and initiates a primary innate immune response by inducing mitochondrial-nuclear stress signaling with activation of the pro-inflammatory NF-kappaB, NFAT and IRF transcriptional pathways.
Target Involvement
Multicentric osteolysis, nodulosis, and arthropathy (MONA)
Target Subcellular Location
[Isoform 1]: Secreted, extracellular space, extracellular matrix. Membrane. Nucleus. Note=Colocalizes with integrin alphaV/beta3 at the membrane surface in angiogenic blood vessels and melanomas. Found in mitochondria, along microfibrils, and in nuclei of cardiomyocytes.; [Isoform 2]: Cytoplasm. Mitochondrion.
Target Protein Families
Peptidase M10A family
Target Tissue Specificity
Produced by normal skin fibroblasts. PEX is expressed in a number of tumors including gliomas, breast and prostate.
Target Synonyms
72 kDa gelatinase; 72kD type IV collagenase; CLG 4; CLG 4A; CLG4; CLG4A; Collagenase Type 4 alpha; Collagenase type IV A; Gelatinase A; Gelatinase alpha; Gelatinase neutrophil; Matrix metallopeptidase 2 gelatinase A 72kDa gelatinase 72kDa type IV collagenase; Matrix metalloproteinase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase); Matrix Metalloproteinase 2; Matrix metalloproteinase II; Matrix metalloproteinase-2; MMP 2; MMP II; MMP-2; MMP2; MMP2_HUMAN; MONA; Neutrophil gelatinase; PEX; TBE 1; TBE-1
Target Background
This gene is a member of the matrix metalloproteinase (MMP) gene family, that are zinc-dependent enzymes capable of cleaving components of the extracellular matrix and molecules involved in signal transduction. The protein encoded by this gene is a gelatinase A, type IV collagenase, that contains three fibronectin type II repeats in its catalytic site that allow binding of denatured type IV and V collagen and elastin. Unlike most MMP family members, activation of this protein can occur on the cell membrane. This enzyme can be activated extracellularly by proteases, or, intracellulary by its S-glutathiolation with no requirement for proteolytical removal of the pro-domain. This protein is thought to be involved in multiple pathways including roles in the nervous system, endometrial menstrual breakdown, regulation of vascularization, and metastasis. Mutations in this gene have been associated with Winchester syndrome and Nodulosis-Arthropathy-Osteolysis (NAO) syndrome. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification