-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Myelin Basic Protein was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 161-304 of human Myelin Basic Protein (P02686) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against Myelin Basic Protein was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 161-304 of human Myelin Basic Protein (P02686) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16881A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Myelin Basic Protein |
| Target Synonyms | MBP; myelin basic protein; Myelin Basic Protein | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB, IF/ICC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 161-304 of human Myelin Basic Protein (P02686). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | GFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARR | Uniprot ID | P02686 |
Uniprot Id
P02686
Target Species
Human
Target Name
MBP
Target Full Name
Myelin basic protein
Target Function
The classic group of MBP isoforms (isoform 4-isoform 14) are with PLP the most abundant protein components of the myelin membrane in the CNS. They have a role in both its formation and stabilization. The smaller isoforms might have an important role in remyelination of denuded axons in multiple sclerosis. The non-classic group of MBP isoforms (isoform 1-isoform 3/Golli-MBPs) may preferentially have a role in the early developing brain long before myelination, maybe as components of transcriptional complexes, and may also be involved in signaling pathways in T-cells and neural cells. Differential splicing events combined with optional post-translational modifications give a wide spectrum of isomers, with each of them potentially having a specialized function. Induces T-cell proliferation.
Target Involvement
The reduction in the surface charge of citrullinated and/or methylated MBP could result in a weakened attachment to the myelin membrane. This mechanism could be operative in demyelinating diseases such as chronical multiple sclerosis (MS), and fulminating MS (Marburg disease).
Target Subcellular Location
Myelin membrane; Peripheral membrane protein; Cytoplasmic side. Note=Cytoplasmic side of myelin.; [Isoform 3]: Nucleus. Note=Targeted to nucleus in oligodendrocytes.
Target Protein Families
Myelin basic protein family
Target Tissue Specificity
MBP isoforms are found in both the central and the peripheral nervous system, whereas Golli-MBP isoforms are expressed in fetal thymus, spleen and spinal cord, as well as in cell lines derived from the immune system.
Target Synonyms
GDB; Golli MBP; Golli MBP; myelin basic protein; Hemopoietic MBP ; HMBPR; HUGO; MBP; MBP_CAVPO; MBP_HUMAN; MGC99675; MLD; Myelin A1 protein; Myelin A1 Protein; basic; Myelin basic protein; Myelin Deficient; Myelin membrane encephalitogenic protein; OTTHUMP00000163776; OTTHUMP00000174387; OTTHUMP00000174388; SHI; Shiverer; SP
Target Background
The protein encoded by the classic MBP gene is a major constituent of the myelin sheath of oligodendrocytes and Schwann cells in the nervous system. However, MBP-related transcripts are also present in the bone marrow and the immune system. These mRNAs arise from the long MBP gene (otherwise called 'Golli-MBP') that contains 3 additional exons located upstream of the classic MBP exons. Alternative splicing from the Golli and the MBP transcription start sites gives rise to 2 sets of MBP-related transcripts and gene products. The Golli mRNAs contain 3 exons unique to Golli-MBP, spliced in-frame to 1 or more MBP exons. They encode hybrid proteins that have N-terminal Golli aa sequence linked to MBP aa sequence. The second family of transcripts contain only MBP exons and produce the well characterized myelin basic proteins. This complex gene structure is conserved among species suggesting that the MBP transcription unit is an integral part of the Golli transcription unit and that this arrangement is important for the function and/or regulation of these genes.
Notification