Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Myoglobin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 55-154 of human Myoglobin (P02144) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Myoglobin was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 55-154 of human Myoglobin (P02144) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15998A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Myoglobin |
| Target Synonyms | MYOSB; PVALB; Myoglobin | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Rat heart, Mouse skeletal muscle, Rat skeletal muscle | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 55-154 of human Myoglobin (P02144). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG | Uniprot ID | P02144 |
Uniprot Id
P02144
Target Species
Human
Target Name
MB
Target Full Name
Myoglobin
Target Function
Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles.
Target Protein Families
Globin family
Target Synonyms
MYOSB; PVALB; Myoglobin
Target Background
This gene encodes a member of the globin superfamily and is predominantly expressed in skeletal and cardiac muscles. The encoded protein forms a monomeric globular haemoprotein that is primarily responsible for the storage and facilitated transfer of oxygen from the cell membrane to the mitochondria. This protein also plays a role in regulating physiological levels of nitric oxide. Multiple transcript variants encoding distinct isoforms exist for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
