Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Neurokinin 1 Receptor (NK1R) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-407 of human Neurokinin 1 Receptor (NK1R) (NK1R) (P25103) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Neurokinin 1 Receptor (NK1R) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 300-407 of human Neurokinin 1 Receptor (NK1R) (NK1R) (P25103) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16073A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Neurokinin 1 Receptor (NK1R) |
| Target Synonyms | SPR; NK1R; NKIR; TAC1R; Neurokinin 1 Receptor (NK1R) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, Mouse brain, Rat spleen, SH-SY5Y | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 300-407 of human Neurokinin 1 Receptor (NK1R) (NK1R) (P25103). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | YNPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTISTVVGAHEEEPEDGPKATPSSLDLTSNCSSRSDSKTMTESFSFSSNVLS | Uniprot ID | P25103 |
Uniprot Id
P25103
Target Species
Human
Target Name
TACR1
Target Full Name
Substance-P receptor
Target Function
This is a receptor for the tachykinin neuropeptide substance P. It is probably associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is: substance P > substance K > neuromedin-K.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Research Area
Neuroscience
Target Synonyms
Neurokinin 1; Neurokinin 1 Receptor; NK 1 receptor; NK 1R; NK-1 receptor; NK-1R; NK1 receptor; NK1R; NK1R_HUMAN; NKIR; SPR; Substance P receptor; Substance-P receptor; TAC 1R; TAC1R; Tachykinin 1 receptor (substance P receptor neurokinin 1 receptor); Tachykinin receptor 1 (substance P receptor neurokinin 1 receptor); Tachykinin receptor 1; TACR1
Target Background
This gene belongs to a gene family of tachykinin receptors. These tachykinin receptors are characterized by interactions with G proteins and contain seven hydrophobic transmembrane regions. This gene encodes the receptor for the tachykinin substance P, also referred to as neurokinin 1. The encoded protein is also involved in the mediation of phosphatidylinositol metabolism of substance P.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
