-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Neuropilin-1 (NRP1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 824-923 of human Neuropilin-1 (NRP1) (O14786) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Neuropilin-1 (NRP1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 824-923 of human Neuropilin-1 (NRP1) (O14786) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15973A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Neuropilin-1 (NRP1) |
| Target Synonyms | NP1; NRP; BDCA4; CD304; VEGF165R; Neuropilin-1 (NRP1) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse heart, Mouse kidney, Rat heart, HUVEC, Mouse lung, Rat lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 824-923 of human Neuropilin-1 (NRP1) (O14786). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | IDETGSTPGYEGEGEGDKNISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYNFELVDGVKLKKDKLNTQSTYSEA | Uniprot ID | O14786 |
Uniprot Id
O14786
Target Species
Human
Target Name
NRP1
Target Full Name
Neuropilin-1
Target Function
Cell-surface receptor involved in the development of the cardiovascular system, in angiogenesis, in the formation of certain neuronal circuits and in organogenesis outside the nervous system. Mediates the chemorepulsant activity of semaphorins. Recognizes a C-end rule (CendR) motif R/KXXR/K on its ligands which causes cellular internalization and vascular leakage. It binds to semaphorin 3A, the PLGF-2 isoform of PGF, the VEGF165 isoform of VEGFA and VEGFB. Coexpression with KDR results in increased VEGF165 binding to KDR as well as increased chemotaxis. Regulates VEGF-induced angiogenesis. Binding to VEGFA initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development. Regulates mitochondrial iron transport via interaction with ABCB8/MITOSUR.; Binds VEGF-165 and may inhibit its binding to cells. May induce apoptosis by sequestering VEGF-165. May bind as well various members of the semaphorin family. Its expression has an averse effect on blood vessel number and integrity.; (Microbial infection) Acts as a host factor for human coronavirus SARS-CoV-2 infection. Recognizes and binds to CendR motif RRAR on SARS-CoV-2 spike protein S1 which enhances SARS-CoV-2 infection.
Target Subcellular Location
[Isoform 2]: Secreted.; Mitochondrion membrane; Single-pass type I membrane protein. Cell membrane; Single-pass type I membrane protein. Cytoplasm.
Target Protein Families
Neuropilin family
Target Tissue Specificity
[Isoform 1]: The expression of isoforms 1 and 2 does not seem to overlap. Expressed by the blood vessels of different tissues. In the developing embryo it is found predominantly in the nervous system. In adult tissues, it is highly expressed in heart and
Target Research Area
Cardiovascular
Target Synonyms
A5 protein; BDCA4; BLOOD DENDRITIC CELL ANTIGEN 4; CD304; Neuropilin-1; Neuropilin1; NP1; NPN1; NRP 1; NRP; NRP1; NRP1_HUMAN; transmembrane receptor; Vascular endothelial cell growth factor 165 receptor; VEGF165R
Target Background
This gene encodes one of two neuropilins, which contain specific protein domains which allow them to participate in several different types of signaling pathways that control cell migration. Neuropilins contain a large N-terminal extracellular domain, made up of complement-binding, coagulation factor V/VIII, and meprin domains. These proteins also contains a short membrane-spanning domain and a small cytoplasmic domain. Neuropilins bind many ligands and various types of co-receptors; they affect cell survival, migration, and attraction. Some of the ligands and co-receptors bound by neuropilins are vascular endothelial growth factor (VEGF) and semaphorin family members. This protein has also been determined to act as a co-receptor for SARS-CoV-2 (which causes COVID-19) to infect host cells.
Notification