-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NgR3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 342-441 of human NgR3 (Q86UN2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against NgR3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 342-441 of human NgR3 (Q86UN2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-13330A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NgR3 |
| Target Synonyms | NgR3; NGRH2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, SH-SY5Y, T47D | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 342-441 of human NgR3 (Q86UN2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PHGPRPGHRKPGKNCTNPRNRNQISKAGAGKQAPELPDYAPDYQHKFSFDIMPTARPKRKGKCARRTPIRAPSGVQQASSASSLGASLLAWTLGLAVTLR | Uniprot ID | Q86UN2 |
Uniprot Id
Q86UN2
Target Species
Human
Target Name
RTN4RL1
Target Full Name
Reticulon-4 receptor-like 1
Target Function
Cell surface receptor. Plays a functionally redundant role in postnatal brain development and in regulating axon regeneration in the adult central nervous system. Contributes to normal axon migration across the brain midline and normal formation of the corpus callosum. Protects motoneurons against apoptosis; protection against apoptosis is probably mediated by MAG. Plays a role in inhibiting neurite outgrowth and axon regeneration via its binding to neuronal chondroitin sulfate proteoglycans. Binds heparin. Like other family members, plays a role in restricting the number dendritic spines and the number of synapses that are formed during brain development. Signaling mediates activation of Rho and downstream reorganization of the actin cytoskeleton.
Target Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor. Membrane raft. Perikaryon. Cell projection.
Target Protein Families
Nogo receptor family
Target Tissue Specificity
Predominantly expressed in brain. Expressed at lower levels in kidney, lung, mammary gland, placenta, salivary gland, skeletal muscle and spleen.
Target Synonyms
DKFZp547J144; NgR 3; NgR3; NGRH 2; NGRH2; NGRL2; Nogo 66 receptor homolog 2; Nogo 66 receptor related protein 3; Nogo receptor like 2; Nogo receptor-like 2; Nogo-66 receptor homolog 2; Nogo-66 receptor-related protein 3; R4RL1_HUMAN; Reticulon 4 receptor like 1; Reticulon-4 receptor-like 1; RTN4RL1
Target Background
Enables signaling receptor activity. Predicted to be involved in negative regulation of axon regeneration. Located in cell surface. Is anchored component of plasma membrane.
Notification