-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against NMDAR2A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1300-1400 of human NMDAR2A (Q12879) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against NMDAR2A was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1300-1400 of human NMDAR2A (Q12879) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16986A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | NMDAR2A |
| Target Synonyms | LKS; EPND; FESD; NR2A; GluN2A; NMDAR2A | Form | Liquid |
| Species Reactivity | Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1300-1400 of human NMDAR2A (Q12879). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RELDLSRPSRSISLKDRERLLEGNFYGSLFSVPSSKLSGKKSSLFPQGLEDSKRSKSLLPDHTSDNPFLHSHRDDQRLVIGRCPSDPYKHSLPSQAVNDSY | Uniprot ID | Q12879 |
Uniprot Id
Q12879
Target Species
Human
Target Name
GRIN2A
Target Full Name
Glutamate receptor ionotropic, NMDA 2A
Target Function
Component of NMDA receptor complexes that function as heterotetrameric, ligand-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Channel activation requires binding of the neurotransmitter glutamate to the epsilon subunit, glycine binding to the zeta subunit, plus membrane depolarization to eliminate channel inhibition by Mg(2+). Sensitivity to glutamate and channel kinetics depend on the subunit composition; channels containing GRIN1 and GRIN2A have lower sensitivity to glutamate and faster deactivation kinetics than channels formed by GRIN1 and GRIN2B. Contributes to the slow phase of excitatory postsynaptic current, long-term synaptic potentiation, and learning.
Target Involvement
Epilepsy, focal, with speech disorder and with or without mental retardation (FESD)
Target Subcellular Location
Cell projection, dendritic spine. Cell membrane; Multi-pass membrane protein. Cell junction, synapse. Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane.
Target Protein Families
Glutamate-gated ion channel (TC 1.A.10.1) family, NR2A/GRIN2A subfamily
Target Research Area
Transport
Target Synonyms
EPND; FESD; GluN2A; Glutamate [NMDA] receptor subunit epsilon-1; Glutamate receptor; Glutamate receptor ionotropic N methyl D aspartate 2A; GRIN 2A; GRIN2A; hNR2A; LKS; N methyl D aspartate receptor channel; subunit epsilon 1; N Methyl D Aspartate Receptor Subtype 2A; N methyl D aspartate receptor subunit 2A; N-methyl D-aspartate receptor subtype 2A; NMDA receptor subtype 2A; NMDAR 2A; NMDAR2A; NMDE1_HUMAN; NR2A; OTTHUMP00000160135; OTTHUMP00000174531
Target Background
This gene encodes a member of the glutamate-gated ion channel protein family. The encoded protein is an N-methyl-D-aspartate (NMDA) receptor subunit. NMDA receptors are both ligand-gated and voltage-dependent, and are involved in long-term potentiation, an activity-dependent increase in the efficiency of synaptic transmission thought to underlie certain kinds of memory and learning. These receptors are permeable to calcium ions, and activation results in a calcium influx into post-synaptic cells, which results in the activation of several signaling cascades. Disruption of this gene is associated with focal epilepsy and speech disorder with or without cognitive disability. Alternative splicing results in multiple transcript variants.
Notification