Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PCPE-1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 304-449 of human TLR4 (NP_002584.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against PCPE-1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 304-449 of human TLR4 (NP_002584.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
Western blot analysis of various lysates, using PCPE-1 Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit.
Negative control (NC):THP-1
Exposure time: 30s.
| Cat.No | ADA-15566A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PCPE-1 |
| Target Synonyms | PCPE; PCPE1; PCPE-1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | U-2 OS | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 304-449 of human TLR4 (NP_002584.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | EKTEESPSAPDAPTCPKQCRRTGTLQSNFCASSLVVTATVKSMVREPGEGLAVTVSLIGAYKTGGLDLPSPPTGASLKFYVPCKQCPPMKKGVSYLLMGQVEENRGPVLPPESFVVLHRPNQDQILTNLSKRKCPSQPVRAAASQD | Uniprot ID | Q15113 |
Uniprot Id
Q15113
Target Species
Human
Target Name
PCOLCE
Target Full Name
Procollagen C-endopeptidase enhancer 1
Target Function
Binds to the C-terminal propeptide of type I procollagen and enhances procollagen C-proteinase activity.; C-terminal processed part of PCPE (CT-PCPE) may have an metalloproteinase inhibitory activity.
Target Subcellular Location
Secreted.
Target Synonyms
PCOC1_HUMAN; Pcolce; PCOLE 1; PCOLE1; PCPE; PCPE-1; PCPE1; Procollagen C endopeptidase enhancer ; Procollagen C-endopeptidase enhancer 1; Procollagen C-endopeptidase enhancer; Procollagen C-proteinase enhancer 1; Procollagen COOH-terminal proteinase enhancer 1; procollagen, type 1, COOH-terminal proteinase enhancer; Type 1 procollagen C-proteinase enhancer protein; Type I procollagen COOH-terminal proteinase enhancer
Target Background
Fibrillar collagen types I-III are synthesized as precursor molecules known as procollagens. These precursors contain amino- and carboxyl-terminal peptide extensions known as N- and C-propeptides, respectively, which are cleaved, upon secretion of procollagen from the cell, to yield the mature triple helical, highly structured fibrils. This gene encodes a glycoprotein which binds and drives the enzymatic cleavage of type I procollagen and heightens C-proteinase activity.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
