Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PGE receptor EP2 (PTGER2) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 259-358 of human PGE receptor EP2 (PTGER2) (P43116) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against PGE receptor EP2 (PTGER2) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 259-358 of human PGE receptor EP2 (PTGER2) (P43116) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14009A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PGE receptor EP2 (PTGER2) |
| Target Synonyms | EP2; PGE receptor EP2 (PTGER2) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, Mouse liver, Mouse lung, Mouse spleen, Rat testis, THP-1 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 259-358 of human PGE receptor EP2 (PTGER2) (P43116). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | ETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQALRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL | Uniprot ID | P43116 |
Uniprot Id
P43116
Target Species
Human
Target Name
PTGER2
Target Full Name
Prostaglandin E2 receptor EP2 subtype
Target Function
Receptor for prostaglandin E2 (PGE2). The activity of this receptor is mediated by G(s) proteins that stimulate adenylate cyclase. The subsequent raise in intracellular cAMP is responsible for the relaxing effect of this receptor on smooth muscle.
Target Subcellular Location
Cell membrane; Multi-pass membrane protein.
Target Protein Families
G-protein coupled receptor 1 family
Target Tissue Specificity
Placenta and lung.
Target Synonyms
PTGER2; Prostaglandin E2 receptor EP2 subtype; PGE receptor EP2 subtype; PGE2 receptor EP2 subtype; Prostanoid EP2 receptor
Target Background
This gene encodes a receptor for prostaglandin E2, a metabolite of arachidonic acid which has different biologic activities in a wide range of tissues. Mutations in this gene are associated with aspirin-induced susceptibility to asthma.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
