-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Phospholipid Scramblase 1 (PLSCR1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Phospholipid Scramblase 1 (PLSCR1) (NP_066928.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Phospholipid Scramblase 1 (PLSCR1) was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Phospholipid Scramblase 1 (PLSCR1) (NP_066928.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14151A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Phospholipid Scramblase 1 (PLSCR1) |
| Target Synonyms | MMTRA1B; Phospholipid Scramblase 1 (PLSCR1) | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HT-29, Mouse lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Phospholipid Scramblase 1 (PLSCR1) (NP_066928.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPPAGHSGPGPAGFPVPNQPVYNQPVYNQPVGAAGVPWMPAPQPPLNCPPGLE | Uniprot ID | O15162 |
Uniprot Id
O15162
Target Species
Human
Target Name
PLSCR1
Target Full Name
Phospholipid scramblase 1
Target Function
Catalyzes calcium-induced ATP-independent rapid bidirectional and non-specific movement of phospholipids (lipid scrambling or lipid flip-flop) between the inner and outer leaflet of the plasma membrane resulting in collapse of the phospholipid asymmetry which leads to phosphatidylserine externalization on the cell surface. Mediates calcium-dependent phosphatidylserine externalization and apoptosis in neurons via its association with TRPC5. Also exhibits magnesium-dependent nuclease activity against double-stranded DNA and RNA but not single-stranded DNA and can enhance DNA decatenation mediated by TOP2A. Negatively regulates FcR-mediated phagocytosis in differentiated macrophages. May contribute to cytokine-regulated cell proliferation and differentiation. May play a role in the antiviral response of interferon (IFN) by amplifying and enhancing the IFN response through increased expression of select subset of potent antiviral genes. Acts as an attachment receptor for HCV.
Target Subcellular Location
Cell membrane; Single-pass type II membrane protein. Cell membrane; Lipid-anchor; Cytoplasmic side. Nucleus. Cytoplasm. Cytoplasm, perinuclear region.
Target Protein Families
Phospholipid scramblase family
Target Tissue Specificity
Expressed in platelets, erythrocyte membranes, lymphocytes, spleen, thymus, prostate, testis, uterus, intestine, colon, heart, placenta, lung, liver, kidney and pancreas. Not detected in brain and skeletal muscle.
Target Research Area
Microbiology
Target Synonyms
Ca(2+) dependent phospholipid scramblase 1; Ca(2+)-dependent phospholipid scramblase 1; Erythrocyte phospholipid scramblase; MM1 cell-derived transplantability-associated gene 1b; mouse; homolog of; MmTRA1a; MmTRA1b; Nor1; Phospholipid scramblase 1; PL scramblase 1; PLS1_HUMAN; PLSCR 1; Plscr1; Scramblase1; Tra1; Tra1a; Tra1b; Transplantability-associated protein 1; Tras1; Tras2
Target Background
This gene encodes a phospholipid scramblase family member. The encoded protein is involved in disruption of the asymmetrical distribution of phospholipids between the inner and outer leaflets of the plasma membrane, resulting in externalization of phosphatidylserine. This cell membrane disruption plays an important role in the blood coagulation cascade as well as macrophage clearing of apoptotic cells. The encoded protein has additionally been implicated in gene regulation and interferon-induced antiviral responses.
Notification