-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PSD93/chapsyn-110/DLG2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-700 of human PSD93/chapsyn-110/DLG2 (Q15700) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against PSD93/chapsyn-110/DLG2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 600-700 of human PSD93/chapsyn-110/DLG2 (Q15700) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
| Cat.No | ADA-16238A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PSD93/chapsyn-110/DLG2 |
| Target Synonyms | PSD93; PSD-93; PPP1R58; chapsyn-110; PSD93/chapsyn-110/DLG2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, HeLa, Rat brain, Mouse brain, Mouse lung, Mouse spinal cord, SH-SY5Y, U-251MG | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 600-700 of human PSD93/chapsyn-110/DLG2 (Q15700). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | RRVERKERARLKTVKFNAKPGVIDSKGSFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPERGQEDLILSYEPVTRQEINYTRPVIILGPMKDRINDDLISE | Uniprot ID | Q15700 |
Uniprot Id
Q15700
Target Species
Human
Target Name
DLG2
Target Full Name
Disks large homolog 2
Target Function
Required for perception of chronic pain through NMDA receptor signaling. Regulates surface expression of NMDA receptors in dorsal horn neurons of the spinal cord. Interacts with the cytoplasmic tail of NMDA receptor subunits as well as inward rectifying potassium channels. Involved in regulation of synaptic stability at cholinergic synapses. Part of the postsynaptic protein scaffold of excitatory synapses.
Target Subcellular Location
Cell membrane; Lipid-anchor. Cell junction, synapse, postsynaptic density. Cell junction, synapse. Membrane. Cell projection, axon. Perikaryon.
Target Protein Families
MAGUK family
Target Synonyms
Channel associated protein of synapse 110; Channel associated protein of synapses 110kD; Channel-associated protein of synapse-110; Chapsyn 110; Chapsyn-110; Chapsyn110; Discs; large homolog 2 (Drosophila); Disks large homolog 2; DKFZp781D1854; DKFZp781E0954; Dlg 2; dlg2; DLG2_HUMAN; Dlgh 2; Dlgh2; FLJ37266; Gm1197; MGC131811; Postsynaptic density protein PSD 93; Postsynaptic density protein PSD-93; Postsynaptic density protein PSD93; PSD 93; PSD93
Target Background
This gene encodes a member of the membrane-associated guanylate kinase (MAGUK) family. The encoded protein forms a heterodimer with a related family member that may interact at postsynaptic sites to form a multimeric scaffold for the clustering of receptors, ion channels, and associated signaling proteins. Multiple transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been described, but their full-length nature is not known.
Notification