-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against PSMB9/LMP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 125-219 of human PSMB9/LMP2 (P28065) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against PSMB9/LMP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 125-219 of human PSMB9/LMP2 (P28065) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14040A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | PSMB9/LMP2 |
| Target Synonyms | LMP2; PRAAS3; PSMB6i; RING12; beta1i; PSMB9/LMP2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Mouse spleen, Mouse thymus, Raji, Rat liver, Rat lung, THP-1 | Application | ELISA, WB, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 125-219 of human PSMB9/LMP2 (P28065). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | QREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE | Uniprot ID | P28065 |
Uniprot Id
P28065
Target Species
Human
Target Name
PSMB9
Target Full Name
Proteasome subunit beta type-9
Target Function
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This subunit is involved in antigen processing to generate class I binding peptides. Replacement of PSMB6 by PSMB9 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues.
Target Subcellular Location
Cytoplasm. Nucleus.
Target Protein Families
Peptidase T1B family
Target Synonyms
Beta1i; Large multifunctional peptidase 2; Large multifunctional protease 2; LMP 2; LMP2; Low molecular mass protein 2; Macropain chain 7; MGC70470; Multicatalytic endopeptidase complex chain 7; OTTHUMP00000062982; Proteasome (prosome macropain) subunit beta type 9; proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2); Proteasome beta 9 subunit ; Proteasome catalytic subunit 1i; Proteasome chain 7; Proteasome related gene 2; Proteasome subunit beta 6i; Proteasome subunit beta type 9; Proteasome subunit beta type-9; Proteasome subunit beta-1i; PSB9_HUMAN; PSMB 9; PSMB6i; PSMB9; Really interesting new gene 12 protein; RING 12; RING12; RING12 protein
Target Background
The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. This gene is located in the class II region of the MHC (major histocompatibility complex). Expression of this gene is induced by gamma interferon and this gene product replaces catalytic subunit 1 (proteasome beta 6 subunit) in the immunoproteasome. Proteolytic processing is required to generate a mature subunit.
Notification