-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Rad18 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Rad18 (Q9NS91) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Rad18 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human Rad18 (Q9NS91) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13844A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RAD18 |
| Target Synonyms | RNF73; Rad18 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A-549, K-562, MCF7, Mouse brain, Mouse spleen, Mouse testis, Rat testis | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Rad18 (Q9NS91). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MDSLAESRWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQCPTCCVTVTEPDLKNNRILDELVKSLNFARNHLLQFALESP | Uniprot ID | Q9NS91 |
Uniprot Id
Q9NS91
Target Species
Human
Target Name
RAD18
Target Full Name
E3 ubiquitin-protein ligase RAD18
Target Function
E3 ubiquitin-protein ligase involved in postreplication repair of UV-damaged DNA. Postreplication repair functions in gap-filling of a daughter strand on replication of damaged DNA. Associates to the E2 ubiquitin conjugating enzyme UBE2B to form the UBE2B-RAD18 ubiquitin ligase complex involved in mono-ubiquitination of DNA-associated PCNA on 'Lys-164'. Has ssDNA binding activity.
Target Subcellular Location
Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.
Target Protein Families
RAD18 family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
2810024C04Rik; DNA repair protein rad18; E3 ubiquitin-protein ligase RAD18; EC 6.3.2.-; hHR 18; hHR18; hRAD 18; hRAD18; MGC156682; Postreplication repair E3 ubiquitin-protein ligase RAD18; Postreplication repair protein hRAD18p; Postreplication repair protein RAD18; RAD 18; RAD18; RAD18 homolog (S. cerevisiae); RAD18 homolog; RAD18 S. cerevisiae homolog; RAD18 S. cerevisiae homolog of; RAD18 transcript variant; RAD18_HUMAN; Rad18sc; Radiation sensitivity protein 18; RING finger protein 73; RNF 73; RNF73; Structural maintenance of chromosomes protein 6; YCR066W; YCR66W
Target Background
The protein encoded by this gene is highly similar to S. cerevisiae DNA damage repair protein Rad18. Yeast Rad18 functions through its interaction with Rad6, which is an ubiquitin-conjugating enzyme required for post-replication repair of damaged DNA. Similar to its yeast counterpart, this protein is able to interact with the human homolog of yeast Rad6 protein through a conserved ring-finger motif. Mutation of this motif results in defective replication of UV-damaged DNA and hypersensitivity to multiple mutagens.
Notification