-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Smac/Diablo was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 56-239 of human Smac/Diablo (NP_063940.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against Smac/Diablo was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 56-239 of human Smac/Diablo (NP_063940.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-13995A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Smac/Diablo |
| Target Synonyms | SMAC; DFNA64; Smac/Diablo | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, HeLa, Mouse heart, C2C12, Jurkat, MCF7, Rat lung, Rat testis, SP2/0 | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 56-239 of human Smac/Diablo (NP_063940.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | AVPIAQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED | Uniprot ID | Q9NR28 |
Uniprot Id
Q9NR28
Target Species
Human
Target Name
DIABLO
Target Full Name
Diablo IAP-binding mitochondrial protein
Target Function
Promotes apoptosis by activating caspases in the cytochrome c/Apaf-1/caspase-9 pathway. Acts by opposing the inhibitory activity of inhibitor of apoptosis proteins (IAP). Inhibits the activity of BIRC6/bruce by inhibiting its binding to caspases. Isoform 3 attenuates the stability and apoptosis-inhibiting activity of XIAP/BIRC4 by promoting XIAP/BIRC4 ubiquitination and degradation through the ubiquitin-proteasome pathway. Isoform 3 also disrupts XIAP/BIRC4 interacting with processed caspase-9 and promotes caspase-3 activation. Isoform 1 is defective in the capacity to down-regulate the XIAP/BIRC4 abundance.
Target Involvement
Deafness, autosomal dominant, 64 (DFNA64)
Target Subcellular Location
Mitochondrion. Note=Released into the cytosol when cells undergo apoptosis.
Target Tissue Specificity
Ubiquitously expressed with highest expression in testis. Expression is also high in heart, liver, kidney, spleen, prostate and ovary. Low in brain, lung, thymus and peripheral blood leukocytes. Isoform 3 is ubiquitously expressed.
Target Research Area
Cancer
Target Synonyms
0610041G12Rik; DBLOH_HUMAN; DBOH; DFNA64; diablo; Diablo homolog (Drosophila); Diablo homolog; Diablo homolog mitochondrial ; Diablo IAP binding mitochondrial protein; Diablo like protein; DIABLO S; Direct IAP binding protein with low pI ; Direct IAP-binding protein with low pI; FLJ10537; FLJ25049; mitochondrial; Mitochondrial Smac protein ; Second mitochondria derived activator of caspase ; Second mitochondria-derived activator of caspase; second mitochondrial activator of caspases; SMAC 3; Smac; Smac protein; SMAC3
Target Background
This gene encodes an inhibitor of apoptosis protein (IAP)-binding protein. The encoded mitochondrial protein enters the cytosol when cells undergo apoptosis, and allows activation of caspases by binding to inhibitor of apoptosis proteins. Overexpression of the encoded protein sensitizes tumor cells to apoptosis. A mutation in this gene is associated with young-adult onset of nonsyndromic deafness-64. Alternative splicing results in multiple transcript variants encoding different isoforms.
Notification