-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against SUMO4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human SUMO4 (Q6EEV6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
The antibody against SUMO4 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human SUMO4 (Q6EEV6) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, ELISA.
| Cat.No | ADA-14003A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | SUMO4 |
| Target Synonyms | IDDM5; SMT3H4; SUMO-4; dJ281H8.4; SUMO4 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A-431, Mouse brain, Mouse lung, Raji, Rat lung | Application | ELISA, WB, IF/ICC, IHC-P |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human SUMO4 (Q6EEV6). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY | Uniprot ID | Q6EEV6 |
Uniprot Id
Q6EEV6
Target Species
Human
Target Name
SUMO4
Target Full Name
Small ubiquitin-related modifier 4
Target Function
Ubiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may modulate protein subcellular localization, stability or activity. Upon oxidative stress, conjugates to various anti-oxidant enzymes, chaperones, and stress defense proteins. May also conjugate to NFKBIA, TFAP2A and FOS, negatively regulating their transcriptional activity, and to NR3C1, positively regulating its transcriptional activity. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I.
Target Protein Families
Ubiquitin family, SUMO subfamily
Target Tissue Specificity
Expressed mainly in adult and embryonic kidney. Expressed at various levels in immune tissues, with the highest expression in the lymph node and spleen.
Target Research Area
Cell Biology
Target Synonyms
dJ281H8.4; IDDM5; Small ubiquitin like modifier 4 protein; Small ubiquitin-like protein 4; Small ubiquitin-related modifier 4; SMT3 suppressor of mif two 3 homolog 2; SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae); SMT3H4; SUMO 4; SUMO-4; SUMO4; SUMO4_HUMAN
Target Background
This gene is a member of the SUMO gene family. This family of genes encode small ubiquitin-related modifiers that are attached to proteins and control the target proteins' subcellular localization, stability, or activity. The protein described in this record is located in the cytoplasm and specifically modifies IKBA, leading to negative regulation of NF-kappa-B-dependent transcription of the IL12B gene. A specific polymorphism in this SUMO gene, which leads to the M55V substitution, has been associated with type I diabetes. The RefSeq contains this polymorphism.
Notification