-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TFAM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human TFAM (NP_003192.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ChIP, ELISA.
The antibody against TFAM was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human TFAM (NP_003192.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IF/ICC, IP, ChIP, ELISA.
| Cat.No | ADA-15279A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TFAM |
| Target Synonyms | TCF6; MTTF1; MTTFA; TCF6L1; TCF6L2; TCF6L3; MTDPS15; TFAM | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, K-562, MCF7 | Application | ELISA, WB, ChIP, IF/ICC, IHC-P, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human TFAM (NP_003192.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAFLRSMWGVLSALGRSGAELCTGCGSRLRSPFSFVYLPRWFSSVLASCPKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQ | Uniprot ID | Q00059 |
Uniprot Id
Q00059
Target Species
Human
Target Name
TFAM
Target Full Name
Transcription factor A, mitochondrial
Target Function
Binds to the mitochondrial light strand promoter and functions in mitochondrial transcription regulation. Component of the mitochondrial transcription initiation complex, composed at least of TFB2M, TFAM and POLRMT that is required for basal transcription of mitochondrial DNA. In this complex, TFAM recruits POLRMT to a specific promoter whereas TFB2M induces structural changes in POLRMT to enable promoter opening and trapping of the DNA non-template strand. Required for accurate and efficient promoter recognition by the mitochondrial RNA polymerase. Promotes transcription initiation from the HSP1 and the light strand promoter by binding immediately upstream of transcriptional start sites. Is able to unwind DNA. Bends the mitochondrial light strand promoter DNA into a U-turn shape via its HMG boxes. Required for maintenance of normal levels of mitochondrial DNA. May play a role in organizing and compacting mitochondrial DNA.
Target Involvement
Mitochondrial DNA depletion syndrome 15, hepatocerebral type (MTDPS15)
Target Subcellular Location
Mitochondrion. Mitochondrion matrix, mitochondrion nucleoid.
Target Research Area
Cardiovascular
Target Synonyms
anscription factor 6-like 1; Mitochondrial transcription factor 1; mitochondrial transcription factor A; MtTF1; mtTFA; TCF 6; TCF-6; TCF6; TCF6L1; TCF6L2; TCF6L3; TFAM; TFAM_HUMAN; Transcription factor 6; Transcription factor 6 like 2 (mitochondrial transcription factor); Transcription factor 6 like 2; Transcription factor 6-like 2; transcription factor 6-like 3; Transcription factor A, mitochondrial; Transcription factor A, mitochondrial; Transcription factor A, mitochondrial precursor
Target Background
This gene encodes a key mitochondrial transcription factor containing two high mobility group motifs. The encoded protein also functions in mitochondrial DNA replication and repair. Sequence polymorphisms in this gene are associated with Alzheimer's and Parkinson's diseases. There are pseudogenes for this gene on chromosomes 6, 7, and 11. Alternative splicing results in multiple transcript variants.
Notification