-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against TRAPPC2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TRAPPC2 (P0DI81) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against TRAPPC2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human TRAPPC2 (P0DI81) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-13343A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | TRAPPC2 |
| Target Synonyms | SEDL; SEDT; MIP2A; TRS20; ZNF547L; hYP38334; TRAPPC2P1; TRAPPC2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Rat brain, Mouse brain, Mouse thymus, PC-3, SH-SY5Y, SKOV3 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human TRAPPC2 (P0DI81). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSGSFYFVIVGHHDNPVFEMEFLPAGKAESKDDHRHLNQFIAHAALDLVDENMWLSNNMYLKTVDKFNEWFVSAFVTAGHMRFIMLHDIRQEDGIKNFFT | Uniprot ID | P0DI81 |
Uniprot Id
P0DI81
Target Species
Human
Target Name
TRAPPC2
Target Full Name
Trafficking protein particle complex subunit 2
Target Function
Prevents transcriptional repression and induction of cell death by ENO1. May play a role in vesicular transport from endoplasmic reticulum to Golgi.
Target Involvement
Spondyloepiphyseal dysplasia tarda (SEDT)
Target Subcellular Location
Cytoplasm, perinuclear region. Endoplasmic reticulum-Golgi intermediate compartment. Nucleus. Cytoplasm.
Target Protein Families
TRAPP small subunits family, Sedlin subfamily
Target Tissue Specificity
Expressed in brain, heart, kidney, liver, lung, pancreas, placenta, skeletal muscle, fetal cartilage, fibroblasts, placenta and lymphocytes.
Target Synonyms
TRAPPC2; SEDL; Trafficking protein particle complex subunit 2; Sedlin
Target Background
The protein encoded by this gene is thought to be part of a large multi-subunit complex involved in the targeting and fusion of endoplasmic reticulum-to-Golgi transport vesicles with their acceptor compartment. In addition, the encoded protein can bind c-myc promoter-binding protein 1 and block its transcriptional repression capability. Mutations in this gene are a cause of spondyloepiphyseal dysplasia tarda (SEDT). A processed pseudogene of this gene is located on chromosome 19, and other pseudogenes are found on chromosomes 8 and Y. Alternatively spliced transcript variants have been found for this gene.
Notification