-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against U1A/SNRPA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human U1A/SNRPA (P09012) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
The antibody against U1A/SNRPA was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human U1A/SNRPA (P09012) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, IP, ELISA.
| Cat.No | ADA-13801A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | U1A/SNRPA |
| Target Synonyms | U1A; Mud1; U1-A; U1A/SNRPA | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Rat brain, U-937 | Application | ELISA, WB, IF/ICC, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human U1A/SNRPA (P09012). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MAVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMKGT | Uniprot ID | P09012 |
Uniprot Id
P09012
Target Species
Human
Target Name
SNRPA
Target Full Name
U1 small nuclear ribonucleoprotein A
Target Function
Component of the spliceosomal U1 snRNP, which is essential for recognition of the pre-mRNA 5' splice-site and the subsequent assembly of the spliceosome. U1 snRNP is the first snRNP to interact with pre-mRNA. This interaction is required for the subsequent binding of U2 snRNP and the U4/U6/U5 tri-snRNP. SNRPA binds stem loop II of U1 snRNA. In a snRNP-free form (SF-A) may be involved in coupled pre-mRNA splicing and polyadenylation process. May bind preferentially to the 5'-UGCAC-3' motif on RNAs.
Target Subcellular Location
Nucleus.
Target Protein Families
RRM U1 A/B'' family
Target Research Area
Transcription
Target Synonyms
fc19d01; Mud1; small nuclear ribonucleoprotein polypeptide A; snRNP A; snRNP protein A; SNRPA; SNRPA_HUMAN; U1 small nuclear ribonucleoprotein A; U1 small nuclear RNP specific A; U1 snRNP A; U1 snRNP specific protein A; U1-A; U1A; wu:fc19d01; zgc:77810
Target Background
The protein encoded by this gene associates with stem loop II of the U1 small nuclear ribonucleoprotein, which binds the 5' splice site of precursor mRNAs and is required for splicing. The encoded protein autoregulates itself by polyadenylation inhibition of its own pre-mRNA via dimerization and has been implicated in the coupling of splicing and polyadenylation.
Notification