-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MEK1/MEK2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 170-270of human MEK1/MEK2 (NP_002746.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MEK1/MEK2 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 170-270of human MEK1/MEK2 (NP_002746.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-15498A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MEK1/MEK2 |
| Target Synonyms | CFC3; MAPKK1; MEK1; MKK1; PRKMK1; MEK1/MEK2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 170-270of human MEK1/MEK2 (NP_002746.1). | Immunogen Sequence | SIAVIKGLTYLREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYPIPPPDAKE |
|---|---|---|---|
| Uniprot ID | Q02750, P36507 |
Notification