Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CD267/TACI was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 5-129 of mouse CD267/TACI (NP_067324.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC.
The antibody against CD267/TACI was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 5-129 of mouse CD267/TACI (NP_067324.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on FC.
Flow cytometry: 1X10^6 Neuro-2a cells (negative control, left) and A20 cells (right) were surface-stained with CD267/TACI Rabbit mAb or ABflo? 647 Rabbit IgG isotype control, followed by Alexa Fluor? 647 conjugated goat anti-rabbit pAb staining. Non-fluorescently stained cells were used as blank control (red line).
| Cat.No | ADA-15612A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CD267/TACI |
| Target Synonyms | Taci; 1200009E08Rik; CD267/TACI | Form | Liquid |
| Species Reactivity | Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.05% proclin300, pH7.3. | Purification Method | Affinity purification |
| Application | FC |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 5-129 of mouse CD267/TACI (NP_067324.1). | Target Species | Mouse |
|---|---|---|---|
| Immunogen Sequence | FCPKDQYWDSSRKSCVSCALTCSQRSQRTCTDFCKFINCRKEQGRYYDHLLGACVSCDSTCTQHPQQCAHFCEKRPRSQANLQPELGRPQAGEVEVRSDNSGRHQGSEHGPGLRLSSDQLTLYCT | Uniprot ID | Q9ET35 |
Uniprot Id
Q9ET35
Target Synonyms
Taci; 1200009E08Rik; CD267/TACI
Target Background
Acts upstream of or within B cell homeostasis; hematopoietic progenitor cell differentiation; and negative regulation of B cell proliferation. Located in external side of plasma membrane. Is integral component of plasma membrane. Is expressed in renal vasculature. Used to study systemic lupus erythematosus. Human ortholog(s) of this gene implicated in common variable immunodeficiency. Orthologous to human TNFRSF13B (TNF receptor superfamily member 13B).
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
