Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against AAMP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human AAMP (Q13685) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
The antibody against AAMP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human AAMP (Q13685) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IF/ICC, ELISA.
Western blot analysis of various lysates, using AAMP antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.
| Cat.No | ADA-13281A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | AAMP |
| Target Synonyms | AAMP | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | 293T, A375, MCF7, Mouse liver, Mouse testis, Rat liver, Rat testis | Application | ELISA, WB, IF/ICC |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human AAMP (Q13685). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MESESESGAAADTPPLETLSFHGDEEIIEVVELDPGPPDPDDLAQEMEDVDFEEEEEEEGNEEGWVLEPQEGVVGSMEGPDDSEVTFALHSASVFCVSLD | Uniprot ID | Q13685 |
Uniprot Id
Q13685
Target Species
Human
Target Name
AAMP
Target Full Name
Angio-associated migratory cell protein
Target Function
Plays a role in angiogenesis and cell migration. In smooth muscle cell migration, may act through the RhoA pathway.
Target Subcellular Location
Cell membrane. Cytoplasm.
Target Tissue Specificity
Expressed in metastatic melanoma, liver, skin, kidney, heart, lung, lymph node, skeletal muscle and brain, and also in A2058 melanoma cells and activated T-cells (at protein level). Expressed in blood vessels. Strongly expressed in endothelial cells, cyto
Target Synonyms
AAMPAngio-associated migratory cell protein
Target Background
The gene is a member of the immunoglobulin superfamily. The encoded protein is associated with angiogenesis, with potential roles in endothelial tube formation and the migration of endothelial cells. It may also regulate smooth muscle cell migration via the RhoA pathway. The encoded protein can bind to heparin and may mediate heparin-sensitive cell adhesion.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
