Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ALDH16A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human ALDH16A1 (Q8IZ83) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ALDH16A1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 500-600 of human ALDH16A1 (Q8IZ83) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13448A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | ALDH16A1 |
| Form | Liquid | Species Reactivity | Human, Mouse, Rat |
| Isotype | IgG | Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. |
| Purification Method | Affinity purification | Positive Samples | Mouse kidney, Hep G2, K-562, Mouse large intestine, Mouse liver, Rat liver, RD |
| Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 500-600 of human ALDH16A1 (Q8IZ83). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | NLNYDTFGLAVPSTLPAGPEIGPSPAPPYGLFVGGRFQAPGARSSRPIRDSSGNLHGYVAEGGAKDIRGAVEAAHQAFPGWAGQSPGARAALLWALAAALE | Uniprot ID | Q8IZ83 |
Uniprot Id
Q8IZ83
Target Species
Human
Target Name
ALDH16A1
Target Full Name
Aldehyde dehydrogenase family 16 member A1
Target Synonyms
ALDH16A1Aldehyde dehydrogenase family 16 member A1
Target Background
This gene encodes a member of the aldehyde dehydrogenase superfamily. The family members act on aldehyde substrates and use nicotinamide adenine dinucleotide phosphate (NADP) as a cofactor. This gene is conserved in chimpanzee, dog, cow, mouse, rat, and zebrafish. The protein encoded by this gene interacts with maspardin, a protein that when truncated is responsible for Mast syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
