-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against HB-EGF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human HB-EGF (Q99075) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against HB-EGF was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 50-150 of human HB-EGF (Q99075) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-13770A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | HB-EGF |
| Target Synonyms | DTR; DTS; DTSF; HEGFL; HB-EGF | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, Mouse spleen, Rat spleen, SK-OV-3 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human HB-EGF (Q99075). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | LLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPV | Uniprot ID | Q99075 |
Uniprot Id
Q99075
Target Species
Human
Target Name
HBEGF
Target Full Name
Proheparin-binding EGF-like growth factor
Target Function
Growth factor that mediates its effects via EGFR, ERBB2 and ERBB4. Required for normal cardiac valve formation and normal heart function. Promotes smooth muscle cell proliferation. May be involved in macrophage-mediated cellular proliferation. It is mitogenic for fibroblasts, but not endothelial cells. It is able to bind EGF receptor/EGFR with higher affinity than EGF itself and is a far more potent mitogen for smooth muscle cells than EGF. Also acts as a diphtheria toxin receptor.
Target Subcellular Location
[Heparin-binding EGF-like growth factor]: Secreted, extracellular space. Note=Mature HB-EGF is released into the extracellular space and probably binds to a receptor.; [Proheparin-binding EGF-like growth factor]: Cell membrane; Single-pass type I membrane protein.
Target Research Area
Cancer
Target Synonyms
diphtheria toxin receptor (heparin-binding EGF-like growth factor); diphtheria toxin receptor (heparin-binding epidermal growth factor-like growth factor); Diphtheria toxin receptor; DT R; DT-R; DTR; DTS; DTSF; HB-EGF; HBEGF; HBEGF_HUMAN; HEGFL; Heparin binding EGF like growth factor; Heparin binding epidermal growth factor; Heparin binding epidermal growth factor like growth factor; Heparin-binding EGF-like growth factor; Proheparin binding EGF like growth factor
Target Background
Enables growth factor activity and heparin binding activity. Involved in several processes, including epidermal growth factor receptor signaling pathway; positive regulation of protein kinase B signaling; and positive regulation of wound healing. Located in cell surface and extracellular space. Implicated in glomerulosclerosis and perinatal necrotizing enterocolitis.
Notification