-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against RCC1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RCC1 (P18754) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against RCC1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human RCC1 (P18754) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14110A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | RCC1 |
| Target Synonyms | CHC1; RCC1-I; RCC1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, Mouse spleen, Mouse thymus, Raji, Rat testis, SH-SY5Y | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RCC1 (P18754). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVVQAEAGGMHTVCLSKSGQVYSFGCNDEGALG | Uniprot ID | P18754 |
Uniprot Id
P18754
Target Species
Human
Target Name
RCC1
Target Full Name
Regulator of chromosome condensation
Target Function
Guanine-nucleotide releasing factor that promotes the exchange of Ran-bound GDP by GTP, and thereby plays an important role in RAN-mediated functions in nuclear import and mitosis. Contributes to the generation of high levels of chromosome-associated, GTP-bound RAN, which is important for mitotic spindle assembly and normal progress through mitosis. Via its role in maintaining high levels of GTP-bound RAN in the nucleus, contributes to the release of cargo proteins from importins after nuclear import. Involved in the regulation of onset of chromosome condensation in the S phase. Binds both to the nucleosomes and double-stranded DNA.
Target Subcellular Location
Nucleus. Chromosome. Cytoplasm.
Target Synonyms
Cell cycle regulatory protein; CHC 1; CHC1; Chromosome condensation 1; Chromosome condensation protein 1; Guanine nucleotide releasing protein; HERC2; Ran GEF; RanGEF; RCC 1; RCC1; RCC1 I; RCC1_HUMAN; Regulator of chromosome condensation 1; Regulator of chromosome condensation; SHEP1; SNHG3 RCC1; SNHG3 RCC1 readthrough transcript
Target Background
Enables several functions, including guanyl-nucleotide exchange factor activity; nucleosomal DNA binding activity; and protein heterodimerization activity. Involved in several processes, including G1/S transition of mitotic cell cycle; regulation of mitotic nuclear division; and spindle organization. Located in chromatin; cytoplasm; and nucleus. Part of protein-containing complex.
Notification