-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Lipin 1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 101-200 of human Lipin 1 (Q14693) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against Lipin 1 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 101-200 of human Lipin 1 (Q14693) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-14129A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Lipin 1 |
| Target Synonyms | PAP1; Lipin 1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, Hep G2, Mouse testis, Rat testis, RD | Application | ELISA, WB |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 101-200 of human Lipin 1 (Q14693). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MHLATSPILSEGASRMECQLKRGSVDRMRGLDPSTPAQVIAPSETPSSSSVVKKRRKRRRKSQLDSLKRDDNMNTSEDEDMFPIEMSSDEAMELLESSRT | Uniprot ID | Q14693 |
Uniprot Id
Q14693
Target Species
Human
Target Name
LPIN1
Target Full Name
Phosphatidate phosphatase LPIN1
Target Function
Acts as a magnesium-dependent phosphatidate phosphatase enzyme which catalyzes the conversion of phosphatidic acid to diacylglycerol during triglyceride, phosphatidylcholine and phosphatidylethanolamine biosynthesis and therefore controls the metabolism of fatty acids at different levels. Acts also as nuclear transcriptional coactivator for PPARGC1A/PPARA regulatory pathway to modulate lipid metabolism gene expression. Is involved in adipocyte differentiation. Isoform 1 is recruited at the mitochondrion outer membrane and is involved in mitochondrial fission by converting phosphatidic acid to diacylglycerol.
Target Involvement
Myoglobinuria, acute recurrent, autosomal recessive (ARARM)
Target Subcellular Location
Nucleus membrane. Cytoplasm, cytosol. Endoplasmic reticulum membrane.
Target Protein Families
Lipin family
Target Tissue Specificity
Specifically expressed in skeletal muscle. Also abundant in adipose tissue. Lower levels in some portions of the digestive tract.
Target Synonyms
EC=3.1.3.4; KIAA0188 ; Lipin-1; Lpin1; LPIN1_HUMAN; PAP1; Phosphatidate phosphatase LPIN1
Target Background
This gene encodes a magnesium-ion-dependent phosphatidic acid phosphohydrolase enzyme that catalyzes the penultimate step in triglyceride synthesis including the dephosphorylation of phosphatidic acid to yield diacylglycerol. Expression of this gene is required for adipocyte differentiation and it also functions as a nuclear transcriptional coactivator with some peroxisome proliferator-activated receptors to modulate expression of other genes involved in lipid metabolism. Mutations in this gene are associated with metabolic syndrome, type 2 diabetes, acute recurrent rhabdomyolysis, and autosomal recessive acute recurrent myoglobinuria (ARARM). This gene is also a candidate for several human lipodystrophy syndromes.
Notification