-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against IQGAP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human IQGAP1 (NP_003861.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against IQGAP1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human IQGAP1 (NP_003861.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-14197A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | IQGAP1 |
| Target Synonyms | SAR1; p195; HUMORFA01; IQGAP1 | Form | Liquid |
| Species Reactivity | Human, Mouse | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | Mouse lung, U-87MG | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human IQGAP1 (NP_003861.1). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSAADEVDGLGVARPHYGSVLDNERLTAEEMDERRRQNVAYEYLCHLEEAKRWMEACLGEDLPPTTELEEGLRNGVYLAKLGNFFSPKVVSLKKIYDREQ | Uniprot ID | P46940 |
Uniprot Id
P46940
Target Species
Human
Target Name
IQGAP1
Target Full Name
Ras GTPase-activating-like protein IQGAP1
Target Function
Plays a crucial role in regulating the dynamics and assembly of the actin cytoskeleton. Binds to activated CDC42 but does not stimulate its GTPase activity. It associates with calmodulin. Could serve as an assembly scaffold for the organization of a multimolecular complex that would interface incoming signals to the reorganization of the actin cytoskeleton at the plasma membrane. May promote neurite outgrowth. May play a possible role in cell cycle regulation by contributing to cell cycle progression after DNA replication arrest.
Target Subcellular Location
Cell membrane. Nucleus. Cytoplasm.
Target Tissue Specificity
Expressed in the placenta, lung, and kidney. A lower level expression is seen in the heart, liver, skeletal muscle and pancreas.
Target Synonyms
HUMORFA01; IQ motif containing GTPase activating protein 1; IQGA1_HUMAN; Iqgap1; KIAA0051; p195; Ras GTPase activating like protein 1; Ras GTPase-activating-like protein IQGAP1; RasGAP-like with IQ motifs; SAR1
Target Background
This gene encodes a member of the IQGAP family. The protein contains four IQ domains, one calponin homology domain, one Ras-GAP domain and one WW domain. It interacts with components of the cytoskeleton, with cell adhesion molecules, and with several signaling molecules to regulate cell morphology and motility. Expression of the protein is upregulated by gene amplification in two gastric cancer cell lines.
Notification