-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against hnRNP E2/PCBP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 220-350aa of human hnRNP E2/PCBP2 (NP_001122383.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
The antibody against hnRNP E2/PCBP2 was raised in Rabbit using the recombinant fusion protein containing a sequence corresponding to amino acids 220-350aa of human hnRNP E2/PCBP2 (NP_001122383.1) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IP, ELISA.
| Cat.No | ADA-14553A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | hnRNP E2/PCBP2 |
| Target Synonyms | HNRPE2; HNRNPE2; hnRNP-E2; hnRNP E2/PCBP2 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | C6, HeLa, C2C12, Jurkat, MCF7, Mouse liver, Rat testis | Application | ELISA, WB, IP |
| Immunogen Description | Recombinant fusion protein containing a sequence corresponding to amino acids 220-350aa of human hnRNP E2/PCBP2 (NP_001122383.1) | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | PDLEGPPLEAYTIQGQYAIPQPDLTKLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWGLDASAQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTITGSAASISLAQYL | Uniprot ID | Q15366 |
Uniprot Id
Q15366
Target Species
Human
Target Name
PCBP2
Target Full Name
Poly(rC)-binding protein 2
Target Function
Single-stranded nucleic acid binding protein that binds preferentially to oligo dC. Major cellular poly(rC)-binding protein. Binds also poly(rU). Negatively regulates cellular antiviral responses mediated by MAVS signaling. It acts as an adapter between MAVS and the E3 ubiquitin ligase ITCH, therefore triggering MAVS ubiquitination and degradation.; (Microbial infection) In case of infection by poliovirus, binds to the viral internal ribosome entry site (IRES) and stimulates the IRES-mediated translation. Also plays a role in initiation of viral RNA replication in concert with the viral protein 3CD.
Target Subcellular Location
Nucleus. Cytoplasm. Note=Loosely bound in the nucleus. May shuttle between the nucleus and the cytoplasm.
Target Tissue Specificity
Detected in all tissues examined.
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
Alpha CP2; Alpha-CP2; alphaCP-2; Cbp; CTBP; Heterogeneous nuclear ribonucleoprotein E2; Heterogenous nuclear ribonucleoprotein E2; hnRNP E2; hnRNP-E2; HNRNPE2; Hnrnpx; HNRPE2; Hnrpx; MGC110998; PCBP2; PCBP2_HUMAN; poly(rC) binding protein 2; Poly(rC)-binding protein 2; Putative heterogeneous nuclear ribonucleoprotein X; rCbinding protein 2
Target Background
The protein encoded by this gene appears to be multifunctional. Along with PCBP-1 and hnRNPK, it is one of the major cellular poly(rC)-binding proteins. The encoded protein contains three K-homologous (KH) domains which may be involved in RNA binding. Together with PCBP-1, this protein also functions as a translational coactivator of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES, promoting poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1, an intronless gene with functions similar to that of PCBP2. This gene and PCBP-1 have paralogous genes (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. This gene also has two processed pseudogenes (PCBP2P1 and PCBP2P2). Multiple transcript variants encoding different isoforms have been found for this gene.
Notification