-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Tryptophanyl-tRNA synthetase 1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 372-471 of human Tryptophanyl-tRNA synthetase 1 (P23381) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
The antibody against Tryptophanyl-tRNA synthetase 1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 372-471 of human Tryptophanyl-tRNA synthetase 1 (P23381) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on IHC-P, ELISA.
| Cat.No | ADA-14898A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Tryptophanyl-tRNA synthetase 1 |
| Target Synonyms | HMN9; WARS; IFI53; IFP53; GAMMA-2; Tryptophanyl-tRNA synthetase 1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Application | ELISA, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 372-471 of human Tryptophanyl-tRNA synthetase 1 (P23381). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | VNKHAFSGGRDTIEEHRQFGGNCDVDVSFMYLTFFLEDDDKLEQIRKDYTSGAMLTGELKKALIEVLQPLIAEHQARRKEVTDEIVKEFMTPRKLSFDFQ | Uniprot ID | P23381 |
Uniprot Id
P23381
Target Species
Human
Target Name
WARS
Target Full Name
Tryptophan--tRNA ligase, cytoplasmic
Target Function
Isoform 1, isoform 2 and T1-TrpRS have aminoacylation activity while T2-TrpRS lacks it. Isoform 2, T1-TrpRS and T2-TrpRS possess angiostatic activity whereas isoform 1 lacks it. T2-TrpRS inhibits fluid shear stress-activated responses of endothelial cells. Regulates ERK, Akt, and eNOS activation pathways that are associated with angiogenesis, cytoskeletal reorganization and shear stress-responsive gene expression.
Target Subcellular Location
Cytoplasm.
Target Protein Families
Class-I aminoacyl-tRNA synthetase family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
Gamma 2; GAMMA-2; Gamma2; hWRS; IFI 53; IFI53; IFP 53; IFP53; Interferon induced protein 53; Interferon-induced protein 53; SYWC_HUMAN; T2-TrpRS; TrpRS; Tryptophan tRNA ligase; cytoplasmic; Tryptophan tRNA ligase 1 cytoplasmic; Tryptophan tRNA ligase; Tryptophan--tRNA ligase; Tryptophanyl tRNA synthetase ; Tryptophanyl tRNA synthetase cytoplasmic; WARS; WARS protein; WRS
Target Background
Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family. Four transcript variants encoding two different isoforms have been found for this gene.
Notification