-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against Histone H3.3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 57-136 of human Histone H3.3 (P84243) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ChIP, ChIP-seq, ELISA.
The antibody against Histone H3.3 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 57-136 of human Histone H3.3 (P84243) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, IP, ChIP, ChIP-seq, ELISA.
| Cat.No | ADA-15814A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Histone H3.3 |
| Target Synonyms | H3F3; H3-3B; H3.3A; H3F3A; BRYLIB1; Histone H3.3 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat, Other (Wide Range Predicted) | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 294T, Mouse lungRat lung | Application | ELISA, WB, ChIP, ChIP-seq, IHC-P, IP |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 57-136 of human Histone H3.3 (P84243). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | KSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA | Uniprot ID | P84243 |
Uniprot Id
P84243
Target Species
Human
Target Name
H3-3A
Target Full Name
Histone H3.3
Target Function
Variant histone H3 which replaces conventional H3 in a wide range of nucleosomes in active genes. Constitutes the predominant form of histone H3 in non-dividing cells and is incorporated into chromatin independently of DNA synthesis. Deposited at sites of nucleosomal displacement throughout transcribed genes, suggesting that it represents an epigenetic imprint of transcriptionally active chromatin. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
Target Involvement
Glioma (GLM)
Target Subcellular Location
Nucleus. Chromosome.
Target Protein Families
Histone H3 family
Target Research Area
Epigenetics and Nuclear Signaling
Target Synonyms
H3 histone family 3A; H3 histone family 3B; H3 histone; family 3B (H3.3B); H3.3; H3.3A; H3.3B; H33_HUMAN; H3F3; H3F3A; H3f3b; Histone H3.3; Histone H3.3Q; Histone H3.A; Histone H3.B; MGC87782; MGC87783
Target Background
Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene contains introns and its mRNA is polyadenylated, unlike most histone genes. The protein encoded by this gene is a replication-independent histone that is a member of the histone H3 family. Pseudogenes of this gene have been identified on the X chromosome, and on chromosomes 5, 13 and 17.
Notification