-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against CA125 / MUC16 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 12200-12300 of human CA125 / MUC16 (NP_078966.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against CA125 / MUC16 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 12200-12300 of human CA125 / MUC16 (NP_078966.2) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15858A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | CA125 / MUC16 |
| Target Synonyms | CA125; CA-125 ; CA125 / MUC16 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | OVCAR3 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 12200-12300 of human CA125 / MUC16 (NP_078966.2). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TSTPGTSTVDVGTSGTPSSSPSPTTAGPLLMPFTLNFTITNLQYEEDMRRTGSRKFNTMESVLQGLLKPLFKNTSVGPLYSGCRLTLLRPEKDGAATGVDA | Uniprot ID | Q8WXI7 |
Uniprot Id
Q8WXI7
Target Species
Human
Target Name
MUC16
Target Full Name
Mucin-16
Target Function
Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.
Target Subcellular Location
Cell membrane; Single-pass type I membrane protein. Secreted, extracellular space. Note=May be liberated into the extracellular space following the phosphorylation of the intracellular C-terminus which induces the proteolytic cleavage and liberation of the extracellular domain.
Target Tissue Specificity
Expressed in corneal and conjunctival epithelia (at protein level). Overexpressed in ovarian carcinomas and ovarian low malignant potential (LMP) tumors as compared to the expression in normal ovarian tissue and ovarian adenomas.
Target Research Area
Cancer
Target Synonyms
Ovarian cancer-related tumor marker CA125 (CA-125) (Ovarian carcinoma antigen CA125)
Target Background
This gene encodes a protein that is a member of the mucin family. Mucins are high molecular weight, O-glycosylated proteins that play an important role in forming a protective mucous barrier, and are found on the apical surfaces of the epithelia. The encoded protein is a membrane-tethered mucin that contains an extracellular domain at its amino terminus, a large tandem repeat domain, and a transmembrane domain with a short cytoplasmic domain. The amino terminus is highly glycosylated, while the repeat region contains 156 amino acid repeats unit that are rich in serines, threonines, and prolines. Interspersed within the repeats are Sea urchin sperm protein Enterokinase and Agrin (SEA) modules, leucine-rich repeats and ankyrin (ANK) repeats. These regions together form the ectodomain, and there is a potential cleavage site found near an SEA module close to the transmembrane domain. This protein is thought to play a role in forming a barrier, protecting epithelial cells from pathogens. Products of this gene have been used as a marker for different cancers, with higher expression levels associated with poorer outcomes.
Notification