Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against MSR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MSR1 (P21757) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
The antibody against MSR1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human MSR1 (P21757) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, IHC-P, ELISA.
| Cat.No | ADA-15911A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | MSR1 |
| Target Synonyms | SRA; SR-A; CD204; SR-AI; phSR1; phSR2; SCARA1; SR-AII; SR-AIII; MSR1 | Form | Liquid |
| Species Reactivity | Human, Mouse, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, NIH/3T3, C6+LPS+TPA, HepG2 | Application | ELISA, WB, IHC-P |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MSR1 (P21757). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MEQWDHFHNQQEDTDSCSESVKFDARSMTALLPPNPKNSPSLQEKLKSFKAALIALYLLVFAVLIPLIGIVAAQLLKWETKNCSVSSTNANDITQSLTGK | Uniprot ID | P21757 |
Uniprot Id
P21757
Target Species
Human
Target Name
MSR1
Target Full Name
Macrophage scavenger receptor types I and II
Target Function
Membrane glycoproteins implicated in the pathologic deposition of cholesterol in arterial walls during atherogenesis. Two types of receptor subunits exist. These receptors mediate the endocytosis of a diverse group of macromolecules, including modified low density lipoproteins (LDL). Isoform III does not internalize acetylated LDL.
Target Involvement
Prostate cancer (PC); Barrett esophagus (BE)
Target Subcellular Location
Membrane; Single-pass type II membrane protein.
Target Tissue Specificity
Isoform I, isoform II and isoform III are expressed in monocyte-derived macrophages. Isoform I and isoform II are expressed in the liver, placenta and brain.
Target Synonyms
MSR1; SCARA1; Macrophage scavenger receptor types I and II; Macrophage acetylated LDL receptor I and II; Scavenger receptor class A member 1; CD antigen CD204
Target Background
This gene encodes the class A macrophage scavenger receptors, which include three different types (1, 2, 3) generated by alternative splicing of this gene. These receptors or isoforms are macrophage-specific trimeric integral membrane glycoproteins and have been implicated in many macrophage-associated physiological and pathological processes including atherosclerosis, Alzheimer's disease, and host defense. The isoforms type 1 and type 2 are functional receptors and are able to mediate the endocytosis of modified low density lipoproteins (LDLs). The isoform type 3 does not internalize modified LDL (acetyl-LDL) despite having the domain shown to mediate this function in the types 1 and 2 isoforms. It has an altered intracellular processing and is trapped within the endoplasmic reticulum, making it unable to perform endocytosis. The isoform type 3 can inhibit the function of isoforms type 1 and type 2 when co-expressed, indicating a dominant negative effect and suggesting a mechanism for regulation of scavenger receptor activity in macrophages.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
