-
Chinese (Simplified)
-
English
-
German
-
Korean
-
Spanish
Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against C/EBPB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 246-345 of human C/EBPB (P17676) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against C/EBPB was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 246-345 of human C/EBPB (P17676) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-15954A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | C/EBPB |
| Target Synonyms | TCF5; IL6DBP; NF-IL6; C/EBP-beta; C/EBPB | Form | Liquid |
| Species Reactivity | Human, Rat | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, 293T, A-549, MCF7, Rat liver, Rat lung | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 246-345 of human C/EBPB (P17676). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | TACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC | Uniprot ID | P17676 |
Uniprot Id
P17676
Target Species
Human
Target Name
CEBPB
Target Full Name
CCAAT/enhancer-binding protein beta
Target Function
Important transcription factor regulating the expression of genes involved in immune and inflammatory responses. Plays also a significant role in adipogenesis, as well as in the gluconeogenic pathway, liver regeneration, and hematopoiesis. The consensus recognition site is 5'-TEssential for gene expression induction in activated macrophages. Plays a major role in immune responses such as CD4(+) T-cell response, granuloma formation and endotoxin shock. Not essential for intracellular bacteria killing.; Acts as a dominant negative through heterodimerization with isoform 2. Promotes osteoblast differentiation and osteoclastogenesis.
Target Subcellular Location
Nucleus. Cytoplasm.
Target Protein Families
BZIP family, C/EBP subfamily
Target Tissue Specificity
Expressed at low levels in the lung, kidney and spleen.
Target Synonyms
AGP/EBP; C EBP beta; C/EBP beta; C/EBP related protein 2; CCAAT Enhancer Binding Protein beta; CCAAT/enhancer-binding protein beta; CEBPB; CEBPB_HUMAN; CRP2; IL 6DBP; IL6DBP; Interleukin 6 dependent binding protein; LAP; Liver activator protein; Liver enriched transcriptional activator; NF IL6; NFIL6; Nuclear factor NF IL6; Nuclear factor NF-IL6; SF B; SFB; Silencer factor B; TCF-5; TCF5; Transcription factor 5
Target Background
This intronless gene encodes a transcription factor that contains a basic leucine zipper (bZIP) domain. The encoded protein functions as a homodimer but can also form heterodimers with CCAAT/enhancer-binding proteins alpha, delta, and gamma. Activity of this protein is important in the regulation of genes involved in immune and inflammatory responses, among other processes. The use of alternative in-frame AUG start codons results in multiple protein isoforms, each with distinct biological functions.
Notification