Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against ATOH1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATOH1 (Q92858) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against ATOH1 was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATOH1 (Q92858) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16004A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | Atoh1 |
| Target Synonyms | ATH1; HATH1; DFNA89; MATH-1; bHLHa14; ATOH1 | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | HeLa, A549, HCT116 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ATOH1 (Q92858). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | MSRLLHAEEWAEVKELGDHHRQPQPHHLPQPPPPPQPPATLQAREHPVYPPELSLLDSTDPRAWLAPTLQGICTARAAQYLLHSPELGASEAAAPRDEVD | Uniprot ID | Q92858 |
Uniprot Id
Q92858
Target Species
Human
Target Name
ATOH1
Target Full Name
Transcription factor ATOH1
Target Function
Transcriptional regulator. Activates E box-dependent transcription in collaboration with TCF3/E47, but the activity is completely antagonized by the negative regulator of neurogenesis HES1. Plays a role in the differentiation of subsets of neural cells by activating E box-dependent transcription.
Target Subcellular Location
Nucleus.
Target Research Area
Epigenetics and Nuclear Signaling, Developmental Biology
Target Synonyms
ATH1; ATOH1; ATOH1_HUMAN; Atonal homolog 1 (Drosophila); Atonal homolog 1; bHLHa14; Class A basic helix-loop-helix protein 14; hATH1; Helix loop helix protein hATH 1; Helix-loop-helix protein hATH-1; MATH 1; MATH1; Protein atonal homolog 1
Target Background
Enables sequence-specific double-stranded DNA binding activity. Predicted to be involved in neuron differentiation; positive regulation of neuron differentiation; and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including generation of neurons; inner ear morphogenesis; and positive regulation of inner ear auditory receptor cell differentiation. Predicted to be part of chromatin. Predicted to be active in nucleus.
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
