Chinese (Simplified)
English
German
Korean
Spanish
Sign up for an account to enjoy easy online shopping and instant order tracking.
The antibody against FLAP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 62-161 of human FLAP (P20292) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
The antibody against FLAP was raised in Rabbit using a synthetic peptide corresponding to a sequence within amino acids 62-161 of human FLAP (P20292) as the immunogen. The monoclonal antibody exists as a isotype IgG, by affinity purification. This antibody has been validated on WB, ELISA.
| Cat.No | ADA-16230A | Clonality | Monoclonal |
|---|---|---|---|
| Host Species | Rabbit | Target Name | FLAP |
| Target Synonyms | FLAP | Form | Liquid |
| Species Reactivity | Human | Isotype | IgG |
| Storage Buffer | 50% Glycerol, 0.05% BSA, PBS with 0.02% sodium azide, pH7.3. | Purification Method | Affinity purification |
| Positive Samples | A-549, THP-1, U-937 | Application | ELISA, WB |
| Immunogen Description | A synthetic peptide corresponding to a sequence within amino acids 62-161 of human FLAP (P20292). | Target Species | Human |
|---|---|---|---|
| Immunogen Sequence | DAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIILFLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP | Uniprot ID | P20292 |
Uniprot Id
P20292
Target Species
Human
Target Name
ALOX5AP
Target Full Name
Arachidonate 5-lipoxygenase-activating protein
Target Function
Required for leukotriene biosynthesis by ALOX5 (5-lipoxygenase). Anchors ALOX5 to the membrane. Binds arachidonic acid, and could play an essential role in the transfer of arachidonic acid to ALOX5. Binds to MK-886, a compound that blocks the biosynthesis of leukotrienes.
Target Involvement
Ischemic stroke (ISCHSTR)
Target Subcellular Location
Nucleus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Target Protein Families
MAPEG family
Target Synonyms
ALOX5AP; FLAP; Arachidonate 5-lipoxygenase-activating protein; MK-886-binding protein
Free shipping on orders $999+
Advenit post multos Scudilo Scutariorum tribunus velament
We accept credit cards, PayPal, and bank wires
Responsive and knowledgable customer service via email, text or phone
Notification
